FIP1/RCP Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: FIP1/RCP Antibody [NBP1-83598] - Staining of human cell line U-2 OS shows localization to cytosol & vesicles.
Immunohistochemistry-Paraffin: FIP1/RCP Antibody [NBP1-83598] - Staining of human duodenum shows strong membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FIP1/RCP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ASVPSIDSMMRKLEEMGLNLRKDQKKTKKRVSFSEQLFTEEAVAGAALLVEGHSSCPQELNPAWSVAG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RAB11FIP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FIP1/RCP Protein (NBP1-83598PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FIP1/RCP Antibody

  • DKFZp686E2214
  • EC 3.2.1.28
  • EC 6.1.1.7
  • FLJ22524
  • FLJ22622
  • MGC78448
  • NOEL1A
  • RAB11 coupling protein
  • RAB11 family interacting protein 1 (class I)
  • rab11 family-interacting protein 1
  • Rab11-FIP1
  • Rab-coupling protein
  • Rab-interacting recycling protein
  • RCPRab effector protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-49320
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NLS6731
Species: Hu, Rt, Po, Bv, Ca, Eq, Gt, Ha, Mk, Pm, Rb, Xp
Applications: IHC-P
NBP1-05164
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP1-84495
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
AF1052
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-81855
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2898
Species: Mu
Applications: WB, IP
AF6428
Species: Hu
Applications: WB, IHC
NBP1-80732
Species: Hu
Applications: IHC, IHC-P
NBP1-92311
Species: Hu
Applications: IHC, IHC-P
AF2086
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB110-74730
Species: Mu, Rt
Applications: WB, IHC, IHC-P
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP1-91937
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-51599
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-37485
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NBP1-83598
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for FIP1/RCP Antibody (NBP1-83598) (0)

There are no publications for FIP1/RCP Antibody (NBP1-83598).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FIP1/RCP Antibody (NBP1-83598) (0)

There are no reviews for FIP1/RCP Antibody (NBP1-83598). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FIP1/RCP Antibody (NBP1-83598) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FIP1/RCP Products

Bioinformatics Tool for FIP1/RCP Antibody (NBP1-83598)

Discover related pathways, diseases and genes to FIP1/RCP Antibody (NBP1-83598). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FIP1/RCP Antibody (NBP1-83598)

Discover more about diseases related to FIP1/RCP Antibody (NBP1-83598).
 

Pathways for FIP1/RCP Antibody (NBP1-83598)

View related products by pathway.

PTMs for FIP1/RCP Antibody (NBP1-83598)

Learn more about PTMs related to FIP1/RCP Antibody (NBP1-83598).

Blogs on FIP1/RCP

There are no specific blogs for FIP1/RCP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FIP1/RCP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RAB11FIP1
Entrez
Uniprot