RAB11FIP5 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: RAB11FIP5 Antibody [NBP1-81855] - Staining in human testis and endometrium tissues using anti-RAB11FIP5 antibody. Corresponding RAB11FIP5 RNA-seq data are ...read more
Western Blot: RAB11FIP5 Antibody [NBP1-81855] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more
Immunocytochemistry/ Immunofluorescence: RAB11FIP5 Antibody [NBP1-81855] - Staining of human cell line A-431 shows localization to microtubule organizing center & vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: RAB11FIP5 Antibody [NBP1-81855] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: RAB11FIP5 Antibody [NBP1-81855] - Staining of human testis shows high expression.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, KO
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

RAB11FIP5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SPHPVKPLSAAPVEGSPDRKQSRSSLSIALSSGLEKLKTVTSGSIQPVTQAPQAGQMVDTKRLKDSAVLDQSAKYYHLTHDELISLLLQRERELSQRDEHVQEL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RAB11FIP5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockout Validated -Reactivity reported in (PMID: 31988382)
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
70 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
RAB11FIP5 Protein (NBP1-81855PEP)
Publications
Read Publication using
NBP1-81855 in the following applications:

  • KO
    1 publication
  • WB
    1 publication

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RAB11FIP5 Antibody

  • DKFZp434H018
  • Gaf-1
  • GAF1rab11-FIP5
  • Gamma-SNAP-associated factor 1
  • KIAA0857gaf-1
  • Phosphoprotein pp75
  • pp75
  • RAB11 family interacting protein 5 (class I)
  • Rab11-FIP5
  • Rab11-interacting protein Rip11
  • RAB11RIP5
  • RIP11rab11 family-interacting protein 5

Background

Rab effector involved in protein trafficking from apical recycling endosomes to the apical plasma membrane

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RAB11FIP5 Antibody (NBP1-81855)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: KO, WB.


Filter By Application
KO
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for RAB11FIP5 Antibody (NBP1-81855) (0)

There are no reviews for RAB11FIP5 Antibody (NBP1-81855). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RAB11FIP5 Antibody (NBP1-81855) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RAB11FIP5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RAB11FIP5
Entrez
Uniprot