STRA8 Antibody

Images

 
Western Blot: STRA8 Antibody [NBP1-98492] - Human Lung lysate. Antibody at 1.0 ug/mL.
Immunocytochemistry: STRA8 Antibody [NBP1-98492] - Adult mouse testis. ICC image submitted by a verified customer review.
Genetic Strategies: Western Blot: STRA8 Antibody [NBP1-98492] - STRA8ko and wt protein to test stra8 protein level in mouse germ cells. WB image submitted by a verified customer review.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, KO
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

STRA8 Antibody Summary

Immunogen
The immunogen for this antibody is STRA8 - C-terminal region (NP_872295). Peptide sequence PEEKFQLYMQIINFFKGLSCANTQVKQEASFPVDEEMIMLQCTETFDDED. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STRA8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry
  • Knockout Validated
  • Western Blot 1.0 ug/ml
Application Notes
STRA8 Antibody validated for ICC from a verified customer review. STRA8 Antibody validated for KO from a verified customer review.
Theoretical MW
37 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Reviewed Applications
Read 3 Reviews rated 5
using
NBP1-98492 in the following applications:

Reactivity Notes

Mouse reactivity reported from a verified customer review as well as in-house test results.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for STRA8 Antibody

  • stimulated by retinoic acid gene 8 homolog (mouse)
  • stimulated by retinoic acid gene 8 protein homolog

Background

This gene encodes a retinoic acid-responsive protein. A homologous protein in mouse has been shown to be involved in the regulation of meiotic initiation in both spermatogenesis and oogenesis, though feature differences between the mouse and human proteins suggest that these homologs are not entirely functionally equivalent. It is thought that this gene may play a role in spermatogenesis in humans.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-232
Species: Bv, Ch, Fe, Hu, Mu, Pa, Po, Rt
Applications: IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
MAB1759
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, WB
NB100-2437
Species: Ca, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PCR, PEP-ELISA, WB
AF2030
Species: Hu
Applications: IHC, WB
NB100-53810
Species: Hu, Mu
Applications: Flow, IHC, IHC-P, PEP-ELISA
AF1356
Species: Hu, Mu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
NBP1-53169
Species: Hu
Applications: IHC, IHC-P, WB
NBP3-16627
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-181
Species: Hu, Mu
Applications: IP, WB
H00388112-B01P
Species: Hu
Applications: WB
AF1997
Species: Hu
Applications: ChIP, ICC, IHC, WB
NBP2-02667
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-58172
Species: Hu, Mu
Applications: WB
NB200-322
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
7734-LF
Species: Hu
Applications: BA
NBP2-24590
Species: Mu
Applications: IHC, IHC-P, WB
273-F9/CF
Species: Hu
Applications: BA
NBP1-76917
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB

Publications for STRA8 Antibody (NBP1-98492) (0)

There are no publications for STRA8 Antibody (NBP1-98492).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STRA8 Antibody (NBP1-98492) (3) 53

Average Rating: 5
(Based on 3 reviews)
We have 3 reviews tested in 2 species: Human, Mouse.

Reviews using NBP1-98492:
Filter by Applications
Western Blot
(2)
Immunocytochemistry
(1)
All Applications
Filter by Species
Human
(1)
Mouse
(2)
All Species
Images Ratings Applications Species Date Details
Western Blot STRA8 NBP1-98492
Enlarge
5
reviewed by:
xiaoyu zhang
Western Blot Human 08/05/2020
View

Summary

ApplicationWestern Blot
Sample TestedHuman testis
SpeciesHuman
LotQC35907-40983
Western Blot STRA8 NBP1-98492
Enlarge
5
reviewed by:
Nin Wan
Western Blot Mouse 11/11/2019
View

Summary

ApplicationWestern Blot
Sample Testedgerm cells
SpeciesMouse
LotQC35907-40983
Immunocytochemistry STRA8 NBP1-98492
Enlarge
5
reviewed by:
yasuy ohguch
Immunocytochemistry Mouse 10/09/2019
View

Summary

ApplicationImmunocytochemistry
Sample TestedAdult testis
SpeciesMouse
LotQC35907-40983

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for STRA8 Antibody (NBP1-98492) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional STRA8 Products

Array NBP1-98492

Bioinformatics Tool for STRA8 Antibody (NBP1-98492)

Discover related pathways, diseases and genes to STRA8 Antibody (NBP1-98492). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STRA8 Antibody (NBP1-98492)

Discover more about diseases related to STRA8 Antibody (NBP1-98492).
 

Pathways for STRA8 Antibody (NBP1-98492)

View related products by pathway.

PTMs for STRA8 Antibody (NBP1-98492)

Learn more about PTMs related to STRA8 Antibody (NBP1-98492).

Blogs on STRA8

There are no specific blogs for STRA8, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
3
4
0
3
0
2
0
1
0

xiaoyu zhang
08/05/2020
Application: Western Blot
Species: Human

Nin Wan
11/11/2019
Application: Western Blot
Species: Mouse

yasuy ohguch
10/09/2019
Application: Immunocytochemistry
Species: Mouse

Bioinformatics

Gene Symbol STRA8
Entrez
Uniprot