Fibulin 5/DANCE Antibody

Images

 
Immunohistochemistry-Paraffin: Fibulin 5 Antibody [NBP1-90101] - Staining of human smooth muscle shows cytoplasmic positivity in smooth muscle cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Fibulin 5/DANCE Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TYFCSCPPGYILLDDNRSCQDINECEHRNHTCNLQQTCYNLQGGFKCIDPIRCEEPYLRISDNRCMCPAENPGCRDQPFTILYRDMDVVSGRSVPADIFQMQATTRYPGAYYIFQIKSGNEGREFYMRQTGPISATLVMTRPIKGPR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FBLN5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Fibulin 5/DANCE Protein (NBP1-90101PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Fibulin 5/DANCE Antibody

  • ARMD3fibulin-5
  • DANCE
  • DANCEFIBL-5
  • Developmental arteries and neural crest EGF-like protein
  • EVEC
  • FBLN5
  • Fibulin 5
  • UP50
  • UP50FLJ90059
  • Urine p50 protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2076
Species: Hu, Po, Ca, Fe, Gt, GP, Sh
Applications: WB, IHC, IHC-P
NB110-8146
Species: Hu, Po, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IM
NB100-2527
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-82827
Species: Hu
Applications: IHC, IHC-P
NBP1-33479
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF6235
Species: Hu
Applications: WB
NBP1-84724
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84725
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF5945
Species: Hu, Mu, Rt
Applications: WB
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF143
Species: Hu
Applications: WB, Simple Western, IHC
AF3850
Species: Hu
Applications: WB
NBP1-90101
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for Fibulin 5/DANCE Antibody (NBP1-90101) (0)

There are no publications for Fibulin 5/DANCE Antibody (NBP1-90101).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Fibulin 5/DANCE Antibody (NBP1-90101) (0)

There are no reviews for Fibulin 5/DANCE Antibody (NBP1-90101). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Fibulin 5/DANCE Antibody (NBP1-90101) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Fibulin 5/DANCE Products

Bioinformatics Tool for Fibulin 5/DANCE Antibody (NBP1-90101)

Discover related pathways, diseases and genes to Fibulin 5/DANCE Antibody (NBP1-90101). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Fibulin 5/DANCE Antibody (NBP1-90101)

Discover more about diseases related to Fibulin 5/DANCE Antibody (NBP1-90101).
 

Pathways for Fibulin 5/DANCE Antibody (NBP1-90101)

View related products by pathway.

PTMs for Fibulin 5/DANCE Antibody (NBP1-90101)

Learn more about PTMs related to Fibulin 5/DANCE Antibody (NBP1-90101).

Blogs on Fibulin 5/DANCE

There are no specific blogs for Fibulin 5/DANCE, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Fibulin 5/DANCE Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FBLN5
Entrez