Fibulin-3/EFEMP1 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: Fibulin-3/EFEMP1 Antibody [NBP2-57871] - Analysis in human placenta and liver tissues. Corresponding EFEMP1 RNA-seq data are presented for the same tissues.
Western Blot: Fibulin-3/EFEMP1 Antibody [NBP2-57871] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunohistochemistry-Paraffin: Fibulin-3/EFEMP1 Antibody [NBP2-57871] - Staining of human liver shows low positivity in hepatocytes.
Immunohistochemistry-Paraffin: Fibulin-3/EFEMP1 Antibody [NBP2-57871] - Staining of retina shows cytoplasmic positivity in all layers except inner nuclear layer.
Immunohistochemistry-Paraffin: Fibulin-3/EFEMP1 Antibody [NBP2-57871] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Fibulin-3/EFEMP1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RRNPADPQRIPSNPSHRIQCAAGYEQSEHNVCQDIDECTAGTHNCRADQVCINLRGSFACQCPPGYQKRG
Predicted Species
Mouse (94%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EFEMP1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Fibulin-3/EFEMP1 Recombinant Protein Antigen (NBP2-57871PEP)
Publications
Read Publication using NBP2-57871.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Fibulin-3/EFEMP1 Antibody

  • DHRD
  • EFEMP1
  • EGF containing fibulin-like extracellular matrix protein 1
  • EGF-containing fibulin-like extracellular matrix protein 1
  • Extracellular protein S1-5
  • FBLN3
  • FBLN3DRAD
  • FBNLFLJ35535
  • FIBL-3
  • Fibrillin-like protein
  • fibrillin-like
  • Fibulin 3
  • fibulin-3
  • MGC111353
  • MLVT
  • MTLV
  • S1-5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB3095
Species: Hu
Applications: IHC, WB
NBP1-88115
Species: Hu
Applications: ICC/IF, IHC, IHC-P
DVE00
Species: Hu
Applications: ELISA
NBP1-56853
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-84725
Species: Hu
Applications: IHC, IHC-P, WB
H00030008-B01P
Species: Hu
Applications: Flow, WB
973-TM
Species: Hu
Applications: InhibAct
NB100-2076
Species: Bv, Fe, Hu, Rb
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
236-EG
Species: Hu
Applications: BA
NBP1-30032
Species: Bv, Ca, Fe, Hu, Mu, Xp
Applications: ICC/IF, IHC, IHC-Fr, WB
AF3937
Species: Hu
Applications: IHC, Simple Western, WB
AF231
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NB300-164
Species: Ca, Hu, Mu, Po, Pm, Rt(-)
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, WB
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
MMP200
Species: Ca, Hu, Mu, Po, Rt
Applications: ELISA
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB

Publications for Fibulin-3/EFEMP1 Antibody (NBP2-57871)(1)

Reviews for Fibulin-3/EFEMP1 Antibody (NBP2-57871) (0)

There are no reviews for Fibulin-3/EFEMP1 Antibody (NBP2-57871). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Fibulin-3/EFEMP1 Antibody (NBP2-57871) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Fibulin-3/EFEMP1 Products

Bioinformatics Tool for Fibulin-3/EFEMP1 Antibody (NBP2-57871)

Discover related pathways, diseases and genes to Fibulin-3/EFEMP1 Antibody (NBP2-57871). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Fibulin-3/EFEMP1 Antibody (NBP2-57871)

Discover more about diseases related to Fibulin-3/EFEMP1 Antibody (NBP2-57871).
 

Pathways for Fibulin-3/EFEMP1 Antibody (NBP2-57871)

View related products by pathway.

PTMs for Fibulin-3/EFEMP1 Antibody (NBP2-57871)

Learn more about PTMs related to Fibulin-3/EFEMP1 Antibody (NBP2-57871).
 

Research Areas for Fibulin-3/EFEMP1 Antibody (NBP2-57871)

Find related products by research area.

Blogs on Fibulin-3/EFEMP1

There are no specific blogs for Fibulin-3/EFEMP1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Fibulin-3/EFEMP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EFEMP1