Fibulin-3/EFEMP1 Antibody - BSA Free

Immunohistochemistry-Paraffin: Fibulin-3/EFEMP1 Antibody [NBP2-57871] - Analysis in human placenta and liver tissues. Corresponding EFEMP1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Fibulin-3/EFEMP1 Antibody [NBP2-57871] - Staining of human liver shows low positivity in hepatocytes.

Immunohistochemistry-Paraffin: Fibulin-3/EFEMP1 Antibody [NBP2-57871] - Staining of retina shows cytoplasmic positivity in all layers except inner nuclear layer.

Immunohistochemistry-Paraffin: Fibulin-3/EFEMP1 Antibody [NBP2-57871] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Fibulin-3/EFEMP1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Fibulin-3/EFEMP1 Antibody - BSA Free (NBP2-57871) is a polyclonal antibody validated for use in IHC. Anti-Fibulin-3/EFEMP1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RRNPADPQRIPSNPSHRIQCAAGYEQSEHNVCQDIDECTAGTHNCRADQVCINLRGSFACQCPPGYQKRG
• Predicted Species: Mouse (94%), Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EFEMP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Fibulin-3/EFEMP1 Recombinant Protein Antigen (NBP2-57871PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Fibulin-3/EFEMP1 Antibody - BSA Free

• DHRD
• EFEMP1
• EGF containing fibulin-like extracellular matrix protein 1
• EGF-containing fibulin-like extracellular matrix protein 1
• Extracellular protein S1-5
• FBLN3
• FBLN3DRAD
• FBNLFLJ35535
• FIBL-3
• Fibrillin-like protein
• fibrillin-like
• Fibulin 3
• fibulin-3
• MGC111353
• MLVT
• MTLV
• S1-5

Background

EFEMP1 spans approximately 18 kb of genomic DNA and consists of 12 exons. Two transcripts with distinct 5' UTR have been described; the resulting proteins have distinct N-terminal amino acid sequences. Translation initiation from internal methionine residues was observed with in vitro translation. A signal peptide sequence is predicted for translation initiation sites 1, 2, and 4. The protein isoforms contain 5 or 6 calcium-binding EGF2 domains and 5 or 6 EGF2 domains. Mutations in this gene cause the retinal disease Malattia Leventinese.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Fibulin-3/EFEMP1 Antibody (NBP2-57871)(1)

Publication using NBP2-57871

• MacDonald BT, Keshishian H, Mundorff CC et al. TAILS identifies candidate substrates and biomarkers of ADAMTS7, a therapeutic protease target in coronary artery disease Molecular & cellular proteomics : MCP 2022-03-10 [PMID: 35283288]

Bioinformatics

• Gene Symbol: EFEMP1