FHL2 Antibody

Images

 
Western Blot: FHL2 Antibody [NBP1-84978] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: FHL2 Antibody [NBP1-84978] - Immunofluorescent staining of human cell line U-2 OS shows localization to actin filaments & focal adhesion sites.
Immunohistochemistry-Paraffin: FHL2 Antibody [NBP1-84978] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.
Western Blot: FHL2 Antibody [NBP1-84978] - Analysis in human cell line U-2 OS.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FHL2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RFDCHHCNESLFGKKYILREESPYCVVCFETLFANTCEECGKPIGCDCKDLSYKDRHWHEACFHCSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FHL2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FHL2 Protein (NBP1-84978PEP)
Publications
Read Publications using NBP1-84978.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 20029370)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FHL2 Antibody

  • AAG11
  • down-regulated in rhabdomyosarcoma LIM protein
  • DRAL
  • DRALAAG11
  • FHL2
  • FHL-2
  • four and a half LIM domains 2
  • four and a half LIM domains protein 2
  • four and a half LIM-domain protein 2
  • LIM domain protein DRAL
  • Skeletal muscle LIM-protein 3
  • SLIM3
  • SLIM-3
  • SLIM3aging-associated gene 11

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-41385
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-84843
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-26395
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP1-80833
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02654
Species: Hu, Rt
Applications: WB, Flow, ICC/IF
NBP1-47516
Species: Hu, Mu, Ha, Mk, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-1206
Species: Hu, Mu, Rt, Av, Ch, Fi, Ma, Re
Applications: WB, EM, ICC/IF, IHC, IHC-Fr
NBP1-86122
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
AF5900
Species: Hu
Applications: WB
AF4779
Species: Hu
Applications: WB, IHC
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-74512
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-84978
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for FHL2 Antibody (NBP1-84978)(3)

Reviews for FHL2 Antibody (NBP1-84978) (0)

There are no reviews for FHL2 Antibody (NBP1-84978). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FHL2 Antibody (NBP1-84978) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FHL2 Products

Bioinformatics Tool for FHL2 Antibody (NBP1-84978)

Discover related pathways, diseases and genes to FHL2 Antibody (NBP1-84978). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FHL2 Antibody (NBP1-84978)

Discover more about diseases related to FHL2 Antibody (NBP1-84978).
 

Pathways for FHL2 Antibody (NBP1-84978)

View related products by pathway.

PTMs for FHL2 Antibody (NBP1-84978)

Learn more about PTMs related to FHL2 Antibody (NBP1-84978).
 

Research Areas for FHL2 Antibody (NBP1-84978)

Find related products by research area.

Blogs on FHL2

There are no specific blogs for FHL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FHL2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FHL2
Entrez