STX11 Antibody

Images

 
Western Blot: STX11 Antibody [NBP1-86122] - Analysis in human cell line HDLM-2.
Immunohistochemistry-Paraffin: STX11 Antibody [NBP1-86122] - Staining of human lymph node shows strong cytoplasmic positivity in reaction center cells.
Western Blot: STX11 Antibody [NBP1-86122] - Analysis in control (vector only transfected HEK293T lysate) and STX11 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

STX11 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DIVFETDHILESLYRDIRDIQDENQLLVADVKRLGKQNARFLTSMRRLSSIKRDTNSIAKAIKARGEVIHCKLRAMKELSEAAEAQHGPHSAVARISRAQYNALTLTFQRAMHDYNQAEMKQRDNCKIRIQRQLEIMGKEVSGDQIEDM
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STX11
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
WB reported in scientific literature (PMID: 26176172). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
STX11 Protein (NBP1-86122PEP)
Publications
Read Publication using
NBP1-86122 in the following applications:

  • WB
    1 publication

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (84%). Human reactivity reported in scientific literature (PMID: 26176172).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for STX11 Antibody

  • FHL4
  • HLH4
  • HPLH4
  • syntaxin 11
  • syntaxin-11

Background

STX11 encodes a member of the syntaxin family. Syntaxins have been implicated in the targeting and fusion of intracellular transport vesicles. This family member may regulate protein transport among late endosomes and the trans-Golgi network. Mutations in this gene have been associated with familial hemophagocytic lymphohistiocytosis. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-41385
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, PEP-ELISA, WB
AF5900
Species: Hu
Applications: WB
NBP3-17459
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-97512
Species: Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-32660
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-84978
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-04622
Species: Hu, Mu
Applications: ICC/IF, WB
H00005873-M02
Species: Hu, Mu, Rb
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD, S-ELISA, WB
AF8221
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
H00004068-M01
Species: Hu, Mu
Applications: ELISA, Flow, Func, WB
NBP2-20434
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB120-19294
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
202-IL
Species: Hu
Applications: BA
H00001130-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-33414
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MAB2568
Species: Mu
Applications: IHC, WB
AF5354
Species: Hu
Applications: IHC, WB
NBP1-87374
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-86122
Species: Hu
Applications: WB, IHC

Publications for STX11 Antibody (NBP1-86122)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for STX11 Antibody (NBP1-86122) (0)

There are no reviews for STX11 Antibody (NBP1-86122). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for STX11 Antibody (NBP1-86122) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our STX11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol STX11