FGF14 Antibody - BSA Free Summary
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-252 of human FGF14 (NP_787125.1). MVKPVPLFRRTDFKLLLCNHKDLFFLRVSKLLDCFSPKSMWFLWNIFSKGTHMLQCLCGKSLKKNKNPTDPQLKGIVTRLYCRQGYYLQMHPDGALDGTKDDSTNSTLFNLIPVGLRVVAIQGVKTGLYIAMNGEGYLYPSELFTPECKFKESVFENYYVIYSSMLYRQQESGRAWFLGLNKEGQAMKGNRVKKTKPAAHFLPKPLEVAMYREPSLHDVGETVPKPGVTPSKSTSASAIMNGGKPVNKSKTT |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
FGF14 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 1:500 - 1:1000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for FGF14 Antibody - BSA Free
Background
The FGF14 gene codes for a fibroblast growth factor 14 protein that in isoform 1 is 247 amino acids long at 27 kDA and in isoform 2 is 252 amino acids long at 28 kDA. This gene is a member of the fibroblast growth factor (FGF) family so is thought to participate in nervous system development and function. FGF14 is involved in regulation of actin cytoskeleton, MAPK signaling, mitochondrial apoptosis, paxillin pathways, and nuclear receptor activation by vitamin-A. It interacts with genes EGFR, FGFR1, FGFR2, FGFR3, and FGFR4. FGF14 is associated with pancreatitis, gingivitis, breast cancer, ladd syndrome, ataxia, cerebritis, retinitis, neuronitis, and adenocarcinoma.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: BA
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: BA, BA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Rt
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Mu
Applications: BA
Species: Hu, Mu, Rb
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Publications for FGF14 Antibody (NBP3-04588) (0)
There are no publications for FGF14 Antibody (NBP3-04588).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for FGF14 Antibody (NBP3-04588) (0)
There are no reviews for FGF14 Antibody (NBP3-04588).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for FGF14 Antibody (NBP3-04588) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional FGF14 Products
Research Areas for FGF14 Antibody (NBP3-04588)
Find related products by research area.
|
Blogs on FGF14