FGF-9 Antibody - BSA Free

Immunohistochemistry-Paraffin: FGF-9 Antibody [NBP2-62653] - Staining of human kidney shows high expression.

Immunohistochemistry-Paraffin: FGF-9 Antibody [NBP2-62653] - Analysis in human kidney and lymph node tissues using Anti-FGF9 antibody. Corresponding FGF9 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: FGF-9 Antibody [NBP2-62653] - Staining of human lymph node shows low expression as expected.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FGF-9 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit FGF-9 Antibody - BSA Free (NBP2-62653) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MAPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILR
• Predicted Species: Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FGF9
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  FGF-9 Recombinant Protein Antigen (NBP2-62653PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for FGF-9 Antibody - BSA Free

• FGF9
• FGF-9
• fibroblast growth factor 9 (glia-activating factor)
• Fibroblast growth factor 9
• GAF
• glia-activating factor
• HBFG-9
• HBGF-9
• Heparin-binding growth factor 9
• MGC119914
• MGC119915
• SYNS3

Background

The protein encoded by the FGF9 gene is a member of the fibroblast growth factor (FGF) family. FGF family members possessbroad mitogenic and cell survival activities, and are involved in a variety of biological processes, includingembryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein was isolatedas a secreted factor that exhibits a growth-stimulating effect on cultured glial cells. In nervous system, thisprotein is produced mainly by neurons and may be important for glial cell development. Expression of the mouse homologof this gene was found to be dependent on Sonic hedgehog (Shh) signaling. Mice lacking the homolog gene displayed amale-to-female sex reversal phenotype, which suggested a role in testicular embryogenesis. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FGF9