FGF-9 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: MAPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILR |
| Predicted Species |
Mouse (98%), Rat (98%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
FGF9 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:500 - 1:1000
- Immunohistochemistry-Paraffin 1:500 - 1:1000
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for FGF-9 Antibody - BSA Free
Background
The protein encoded by the FGF9 gene is a member of the fibroblast growth factor (FGF) family. FGF family members possessbroad mitogenic and cell survival activities, and are involved in a variety of biological processes, includingembryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein was isolatedas a secreted factor that exhibits a growth-stimulating effect on cultured glial cells. In nervous system, thisprotein is produced mainly by neurons and may be important for glial cell development. Expression of the mouse homologof this gene was found to be dependent on Sonic hedgehog (Shh) signaling. Mice lacking the homolog gene displayed amale-to-female sex reversal phenotype, which suggested a role in testicular embryogenesis. (provided by RefSeq)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Bv, Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: Flow, ICC, IHC, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: BA
Species: Hu
Applications: IHC, Neut, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC, Simple Western, WB
Species: Ca, Hu, Mu, Rb, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Mu
Applications: BA
Species: Mu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu, Mu
Applications: ICC, IHC, Neut, WB
Species: Hu
Applications: BA, BA
Species: Hu, Mu, Rt
Applications: IHC
Publications for FGF-9 Antibody (NBP2-62653) (0)
There are no publications for FGF-9 Antibody (NBP2-62653).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for FGF-9 Antibody (NBP2-62653) (0)
There are no reviews for FGF-9 Antibody (NBP2-62653).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for FGF-9 Antibody (NBP2-62653) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional FGF-9 Products
Research Areas for FGF-9 Antibody (NBP2-62653)
Find related products by research area.
|
Blogs on FGF-9