FGF-8 Antibody (2A11)


ELISA: FGF-8 Antibody (2A11) [H00002253-M05] - Detection limit for recombinant GST tagged FGF8 is approximately 0.3ng/ml as a capture antibody.
Sandwich ELISA: FGF-8 Antibody (2A11) [H00002253-M05] - Detection limit for recombinant GST tagged FGF8 is approximately 0.3ng/ml as a capture antibody.
Proximity Ligation Assay: FGF-8 Antibody (2A11) [H00002253-M05] - Analysis of protein-protein interactions between FGFR2 and FGF8. HeLa cells were stained with anti-FGFR2 rabbit purified polyclonal 1:1200 and anti-FGF8 ...read more

Product Details

Reactivity HuSpecies Glossary
Applications ELISA, PLA

Order Details

FGF-8 Antibody (2A11) Summary

FGF8 (NP_149354 65 a.a. - 133 a.a.) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSR VRVRGAETGLYICMNKKGK
FGF8 (2A11)
IgG2a Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Proximity Ligation Assay
Application Notes
Antibody reactivity against recombinant protein on ELISA. GST alone used as a negative control.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.4)
No Preservative
IgG purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FGF-8 Antibody (2A11)

  • AIGF
  • Androgen-induced growth factor
  • FGF8
  • FGF-8
  • fibroblast growth factor 8 (androgen-induced)
  • fibroblast growth factor 8
  • HBGF-8
  • Heparin-binding growth factor 8
  • MGC149376


The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein is known to be a factor that supports androgen and anchorage independent growth of mammary tumor cells. Overexpression of this gene has been shown to increase tumor growth and angiogensis. The adult expression of this gene is restricted to testes and ovaries. Temporal and spatial pattern of this gene expression suggests its function as an embryonic epithelial factor. Studies of the mouse and chick homologs revealed roles in midbrain and limb development, organogenesis, embryo gastrulation and left-right axis determination. The alternative splicing of this gene results in four transcript variants.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, Flow, IP, CyTOF-ready
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Xp
Applications: WB, IHC, IHC-Fr, IHC-P, IP, IF
Species: Hu
Applications: WB, Simple Western, ICC
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu, Mu, Rt
Species: Mu
Applications: WB, IHC
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, ICC, IHC-FrFl
Species: Hu
Applications: WB, ELISA, IHC-P
Species: Hu
Applications: ELISA, PLA

Publications for FGF-8 Antibody (H00002253-M05) (0)

There are no publications for FGF-8 Antibody (H00002253-M05).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FGF-8 Antibody (H00002253-M05) (0)

There are no reviews for FGF-8 Antibody (H00002253-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FGF-8 Antibody (H00002253-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional FGF-8 Products

Bioinformatics Tool for FGF-8 Antibody (H00002253-M05)

Discover related pathways, diseases and genes to FGF-8 Antibody (H00002253-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FGF-8 Antibody (H00002253-M05)

Discover more about diseases related to FGF-8 Antibody (H00002253-M05).

Pathways for FGF-8 Antibody (H00002253-M05)

View related products by pathway.

PTMs for FGF-8 Antibody (H00002253-M05)

Learn more about PTMs related to FGF-8 Antibody (H00002253-M05).

Research Areas for FGF-8 Antibody (H00002253-M05)

Find related products by research area.

Blogs on FGF-8

There are no specific blogs for FGF-8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FGF-8 Antibody (2A11) and receive a gift card or discount.


Gene Symbol FGF8