FGF-5 Antibody - BSA Free

Western Blot: FGF-5 Antibody [NBP2-59013] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.

Immunocytochemistry/Immunofluorescence: FGF-5 Antibody [NBP2-59013] - Staining of human cell line U-2 OS shows localization to nucleus & nucleoli fibrillar center.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FGF-5 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit FGF-5 Antibody - BSA Free (NBP2-59013) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ALNKRGKAKRGCSPRVKPQHISTHFLPRFKQSEQPELSFTVTVPEKKKPPSPIKPKIPLSAPRKNTNSVKYRLKFRFG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FGF5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  FGF-5 Recombinant Protein Antigen (NBP2-59013PEP)

Reactivity Notes

Mouse 86%, Rat 88%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for FGF-5 Antibody - BSA Free

• FGF5
• FGF-5
• fibroblast growth factor 5
• HBGF-5
• Heparin-binding growth factor 5
• Smag-82

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FGF5