FGF-19 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit FGF-19 Antibody - BSA Free (NBP1-86294) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: EEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
FGF19 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for FGF-19 Antibody - BSA Free
Background
FGF19 (fibroblast growth factor 19), belongs to the FGF family which are involved in cell growth, tissue repair, embryonic development and a number of other biological processes. FGF19 stimulates glucose in adipocytes and is involved in regulating bile acid homeostasis and metabolic state in an endocrine fashion. FGF19 is known to have interactions with FGFR4, FGF1, FGF18, FGF20 and FGF23. FGF19 is currently being studied for research on the following diseases and disorders: diarrhea, obesity, carcinoma insulin resistance, hepatitis and atherosclerosis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
Species: Hu
Applications: DirELISA, IHC, IP, WB
Species: Hu
Applications: ICC
Species: Mu, Rt
Applications: ELISA
Species: Mu
Applications: IHC
Species: Ha, Hu, Pm, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Mu
Applications: IHC
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ELISA
Species: Mu
Applications: WB
Species: Bv, Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu, Mu
Applications: BA
Species: Hu
Applications: DirELISA, IP, WB
Species: Mu
Applications: ELISA, IHC, WB
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu
Applications: BA
Publications for FGF-19 Antibody (NBP1-86294) (0)
There are no publications for FGF-19 Antibody (NBP1-86294).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for FGF-19 Antibody (NBP1-86294) (0)
There are no reviews for FGF-19 Antibody (NBP1-86294).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for FGF-19 Antibody (NBP1-86294) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional FGF-19 Products
Research Areas for FGF-19 Antibody (NBP1-86294)
Find related products by research area.
|
Blogs on FGF-19