FCRN/FCGRT Antibody

Images

 
Western Blot: FCRN/FCGRT Antibody [NBP1-89127] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunohistochemistry-Paraffin: FCRN/FCGRT Antibody [NBP1-89127] - Staining of human liver shows positivity in a subset of cells in sinusoids.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FCRN/FCGRT Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FCGRT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
40 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
FCRN/FCGRT Protein (NBP1-89127PEP)
Publications
Read Publication using NBP1-89127.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FCRN/FCGRT Antibody

  • alpha-chain
  • Fc fragment of IgG, receptor, transporter, alpha
  • FCGRT
  • FcRn alpha chain
  • FCRN
  • FCRNimmunoglobulin receptor, intestinal, heavy chain
  • IgG Fc fragment receptor transporter alpha chain
  • IgG receptor FcRn large subunit p51
  • major histocompatibility complex class I-like Fc receptor
  • Neonatal Fc receptor
  • neonatal Fc-receptor for Ig

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-27946
Species: Mu
Applications: B/N, Flow, IHC-Fr, IP
H00000712-P01
Species: Hu
NB600-922
Species: Ch, Vi
Applications: WB, ELISA, IHC, IHC-P, IP
NBP2-46123
Species: Hu
Applications: WB, IHC, IHC-P, IF
MAB7446
Species: Hu
Applications: Flow, CyTOF-ready
NB100-64852
Species: Hu
Applications: Flow, IHC, IHC-Fr
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00003077-M01
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for FCRN/FCGRT Antibody (NBP1-89127)(1)

Reviews for FCRN/FCGRT Antibody (NBP1-89127) (0)

There are no reviews for FCRN/FCGRT Antibody (NBP1-89127). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FCRN/FCGRT Antibody (NBP1-89127) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FCRN/FCGRT Products

Bioinformatics Tool for FCRN/FCGRT Antibody (NBP1-89127)

Discover related pathways, diseases and genes to FCRN/FCGRT Antibody (NBP1-89127). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FCRN/FCGRT Antibody (NBP1-89127)

Discover more about diseases related to FCRN/FCGRT Antibody (NBP1-89127).
 

Pathways for FCRN/FCGRT Antibody (NBP1-89127)

View related products by pathway.

Blogs on FCRN/FCGRT.

FcRn - neonatal Fc receptor encoded by the FCGRT gene
Antibodies play an important role in the innate immune system by circulating in the bloodstream to fight off invading pathogens. IgG is the most prevalent of the five classes of antibodies (IgA, IgD, IgE, IgG, and IgM) and is the only one transmit...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FCRN/FCGRT Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FCGRT
Entrez
Uniprot