| Reactivity | HuSpecies Glossary |
| Applications | Simple Western, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLK |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | FCGRT |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. See Simple Western Antibody Database for Simple Western validation: Hepatocyte as sample; separated by size; antibody dilution of 1:50; observed molecular weight was 64 kDa; matrix was 12-230 kDa; detected by Chemiluminescence. |
||
| Theoretical MW | 40 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for FCRN/FCGRT Antibody (NBP1-89127)Find related products by research area.
|
|
FcRn - neonatal Fc receptor encoded by the FCGRT gene Antibodies play an important role in the innate immune system by circulating in the bloodstream to fight off invading pathogens. IgG is the most prevalent of the five classes of antibodies (IgA, IgD, IgE, IgG, and IgM) and is the only one transmit... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.