FCRN/FCGRT Antibody - BSA Free

Immunohistochemistry-Paraffin: FCRN/FCGRT Antibody [NBP1-89127] - Staining of human skin shows weak membranous positivity in fibroblasts.

Immunohistochemistry-Paraffin: FCRN/FCGRT Antibody [NBP1-89127] - Staining of human liver shows weak membranous positivity in Kupffer cells.

Immunohistochemistry-Paraffin: FCRN/FCGRT Antibody [NBP1-89127] - Staining of human placenta shows weak membranous positivity in Hofbauer cells.

Immunohistochemistry-Paraffin: FCRN/FCGRT Antibody [NBP1-89127] - Staining of human spleen shows weak membranous positivity in cells in red pulp.

• Reactivity: Hu
• Applications: Simple Western, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FCRN/FCGRT Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit FCRN/FCGRT Antibody - BSA Free (NBP1-89127) is a polyclonal antibody validated for use in IHC and Simple Western. Anti-FCRN/FCGRT Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FCGRT
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Simple Western 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. See Simple Western Antibody Database for Simple Western validation: Hepatocyte as sample; separated by size; antibody dilution of 1:50; observed molecular weight was 64 kDa; matrix was 12-230 kDa; detected by Chemiluminescence.
• Theoretical MW: 40 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  FCRN/FCGRT Protein (NBP1-89127PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for FCRN/FCGRT Antibody - BSA Free

• alpha-chain
• Fc fragment of IgG, receptor, transporter, alpha
• FCGRT
• FcRn alpha chain
• FCRN
• FCRNimmunoglobulin receptor, intestinal, heavy chain
• IgG Fc fragment receptor transporter alpha chain
• IgG receptor FcRn large subunit p51
• major histocompatibility complex class I-like Fc receptor
• Neonatal Fc receptor
• neonatal Fc-receptor for Ig

Background

The FCGRT gene encodes a 365 amino acid long, 39 kDA IgG receptor FcRn large subunit p51 protein that transfers immunoglobulin G antibodies across the placenta from mother to fetus, as well as functions to protect the antibody from degradation. FCGRT interacts with genes CA6, ELANE, AZGP1, B2M, and ALB. It has been linked to diseases such as: lupus, nephritis, leukemia, arthritis, immunodeficiency, epidermolysis bullosa acquisita, persistent fetal circulation syndrome, and pemphigus.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FCRN/FCGRT Antibody (NBP1-89127)(2)

Publications using NBP1-89127

• Deissler HL, Lang GK, Lang GE. Fate of the Fc fusion protein aflibercept in retinal endothelial cells: competition of recycling and degradation Graefe's Archive for Clinical and Experimental Ophthalmology 2019-01-01 [PMID: 30367290]
• Deissler HL, Lang GK, Lang GE. Internalization of bevacizumab by retinal endothelial cells and its intracellular fate: Evidence for an involvement of the neonatal Fc receptor. Exp Eye Res 2016-02-01 [PMID: 26481553]

Bioinformatics

• Gene Symbol: FCGRT
• Entrez:
  • 2217(Human)
• Uniprot:
  • P55899()