Fc gamma RIIA/CD32a Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

Fc gamma RIIA/CD32a Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FCGR2A.
  
  

  Source: E. coli

  Amino Acid Sequence: RISANSTDPVKAAQFEPPGRQMIAIRKRQLEETNNDYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVNSNN

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: FCGR2A
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84589.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 26 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Fc gamma RIIA/CD32a Recombinant Protein Antigen

• CD32 antigen
• CD32a
• CD32MGC23887
• CDw32fc-gamma-RIIa
• Fc fragment of IgG, low affinity IIa, receptor (CD32)
• Fc fragment of IgG, low affinity IIa, receptor for (CD32)
• Fc gamma RIIA
• FCG2
• Fc-gamma RII-a
• Fc-gamma-RIIa
• FcGR
• FCGR2
• FCGR2A
• FCGR2A1
• FcgRIIA
• FCRIIA
• fcRII-a
• IGFR2MGC30032
• IgG Fc receptor II-a
• Immunoglobulin G Fc receptor II
• low affinity immunoglobulin gamma Fc region receptor II-a

Background

The FCGR2A gene encodes a low affinity immunoglobulin gamma Fc region receptor II-a protein that in isoform 1 is 317 amino acids long at 35 kDA and at isoform 2 is 316 amino acids long at nearly 35 kDA. These proteins are found on the surface of many immune system response cells that act as a low affinity receptor through encouraging responses against pathogens and soluble antigens. Additionally, it functions to initiate phagocytosis of opsonized antigens. FCGR2A participates in Fc-GammaR pathway, osteoclast differentiation, signaling events controlled by PTP1B, and NFAT in immune response. It is known to interact with genes SYK, FYN, HCK, LGALS3, and PIK3R1. FCGR2A is linked to lupus, thrombocytopenia, b-cell lymphomas, otitis media, adult-onset still's disease, guillain-barre syndrome, asymptomatic dengue, severe acute respiratory syndrome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

FAQs for Fc gamma RIIA/CD32a Protein (NBP1-84589PEP). (Showing 1 - 1 of 1 FAQ).

1. Does any of your FCGR2A antibodies (19C10, 6D11, 13G9) cross react to FCGR2B?
   • For these antibodies, we have used the full-length protein FCGR2A (NP_067674) as the immunogen and we have not mapped the epitope that is detected with each Ab yet. I did an alignment of these two proteins and they are highly conserved thus it seems likely that there will be cross-reactivity.

Bioinformatics

• Gene Symbol: FCGR2A