Fc gamma RIIA/CD32a Recombinant Protein Antigen

Images

 
There are currently no images for Fc gamma RIIA/CD32a Protein (NBP1-84589PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Fc gamma RIIA/CD32a Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FCGR2A.

Source: E. coli

Amino Acid Sequence: RISANSTDPVKAAQFEPPGRQMIAIRKRQLEETNNDYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVNSNN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
FCGR2A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84589.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Fc gamma RIIA/CD32a Recombinant Protein Antigen

  • CD32 antigen
  • CD32a
  • CD32MGC23887
  • CDw32fc-gamma-RIIa
  • Fc fragment of IgG, low affinity IIa, receptor (CD32)
  • Fc fragment of IgG, low affinity IIa, receptor for (CD32)
  • Fc gamma RIIA
  • FCG2
  • Fc-gamma RII-a
  • Fc-gamma-RIIa
  • FcGR
  • FCGR2
  • FCGR2A
  • FCGR2A1
  • FcgRIIA
  • FCRIIA
  • fcRII-a
  • IGFR2MGC30032
  • IgG Fc receptor II-a
  • Immunoglobulin G Fc receptor II
  • low affinity immunoglobulin gamma Fc region receptor II-a

Background

The FCGR2A gene encodes a low affinity immunoglobulin gamma Fc region receptor II-a protein that in isoform 1 is 317 amino acids long at 35 kDA and at isoform 2 is 316 amino acids long at nearly 35 kDA. These proteins are found on the surface of many immune system response cells that act as a low affinity receptor through encouraging responses against pathogens and soluble antigens. Additionally, it functions to initiate phagocytosis of opsonized antigens. FCGR2A participates in Fc-GammaR pathway, osteoclast differentiation, signaling events controlled by PTP1B, and NFAT in immune response. It is known to interact with genes SYK, FYN, HCK, LGALS3, and PIK3R1. FCGR2A is linked to lupus, thrombocytopenia, b-cell lymphomas, otitis media, adult-onset still's disease, guillain-barre syndrome, asymptomatic dengue, severe acute respiratory syndrome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

4325-FC
Species: Hu
Applications: Bind
AF1597
Species: Hu
Applications: Block, Simple Western, WB
7268-CT
Species: Hu
Applications: BA
1257-FC
Species: Hu
Applications: Bind
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NB110-89474
Species: Bv, Ce, ChHa, Hu, Pm, Mu, Rt, RM
Applications: Dual ISH-IHC, Flow-CS, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, ISH, Simple Western, Single-Cell Western, WB
6507-IL/CF
Species: Hu
Applications: BA
AF1730
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
NBP2-93743
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
DC140
Species: Hu
Applications: ELISA
DY1707
Species: Hu
Applications: ELISA
AF796
Species: Mu
Applications: AdBlk, IHC, WB
AF629
Species: Hu
Applications: CyTOF-ready, Flow, InhibCellGro, WB
NBP2-29460
Species: Pm, Pm-Cm, Hu, Pm, RM
Applications: Flow, ICC/IF, IHC,  IHC-P, ISH
M6000B
Species: Mu
Applications: ELISA
DY417
Species: Mu
Applications: ELISA
NBP1-84589PEP
Species: Hu
Applications: AC

Publications for Fc gamma RIIA/CD32a Protein (NBP1-84589PEP) (0)

There are no publications for Fc gamma RIIA/CD32a Protein (NBP1-84589PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Fc gamma RIIA/CD32a Protein (NBP1-84589PEP) (0)

There are no reviews for Fc gamma RIIA/CD32a Protein (NBP1-84589PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Fc gamma RIIA/CD32a Protein (NBP1-84589PEP). (Showing 1 - 1 of 1 FAQ).

  1. Does any of your FCGR2A antibodies (19C10, 6D11, 13G9) cross react to FCGR2B?
    • For these antibodies, we have used the full-length protein FCGR2A (NP_067674) as the immunogen and we have not mapped the epitope that is detected with each Ab yet. I did an alignment of these two proteins and they are highly conserved thus it seems likely that there will be cross-reactivity.

Additional Fc gamma RIIA/CD32a Products

Research Areas for Fc gamma RIIA/CD32a Protein (NBP1-84589PEP)

Find related products by research area.

Blogs on Fc gamma RIIA/CD32a

There are no specific blogs for Fc gamma RIIA/CD32a, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Fc gamma RIIA/CD32a Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol FCGR2A