Fc gamma RIIA/CD32a Antibody

Images

 
Western Blot: Fc gamma RIIA/CD32a Antibody [H00002212-B01P] - Analysis of FCGR2A expression in human placenta.
Western Blot: Fc gamma RIIA/CD32a Antibody [H00002212-B01P] - Analysis of FCGR2A expression in transfected 293T cell line by FCGR2A polyclonal antibody. Lane 1: FCGR2A transfected lysate(34.90 KDa). Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Fc gamma RIIA/CD32a Antibody Summary

Immunogen
FCGR2A (AAH20823.1, 1 a.a. - 316 a.a.) full-length human protein. MTMETQMSQNVCPRNLWLLQPLTVLLLLASADSQAAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGVIVAVVIATAVAAIVAAVVALIYCRKKRISANSTDPVKAAQFEPPGRQMIAIRKRQLEETNNDYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVNSNN
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
FCGR2A
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Fc gamma RIIA/CD32a Antibody

  • CD32 antigen
  • CD32a
  • CD32MGC23887
  • CDw32fc-gamma-RIIa
  • Fc fragment of IgG, low affinity IIa, receptor (CD32)
  • Fc fragment of IgG, low affinity IIa, receptor for (CD32)
  • Fc gamma RIIA
  • FCG2
  • Fc-gamma RII-a
  • Fc-gamma-RIIa
  • FcGR
  • FCGR2
  • FCGR2A
  • FCGR2A1
  • FcgRIIA
  • FCRIIA
  • fcRII-a
  • IGFR2MGC30032
  • IgG Fc receptor II-a
  • Immunoglobulin G Fc receptor II
  • low affinity immunoglobulin gamma Fc region receptor II-a

Background

This gene encodes one member of a family of immunoglobulin Fc receptor genes found on the surface of many immune response cells. The protein encoded by this gene is a cell surface receptor found on phagocytic cells such as macrophages and neutrophils, and is involved in the process of phagocytosis and clearing of immune complexes. Alternative splicing results in multiple transcript variants. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-27946
Species: Mu
Applications: B/N, Flow, IHC-Fr, IP
MAB2546
Species: Hu
Applications: Flow, CyTOF-ready
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NB110-89474
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-610
Species: Hu, Ca, GP
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP
NBP1-88968
Species: Hu
Applications: WB, IHC, IHC-P
796-IC
Species: Mu
AF1008
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-29460
Species: Hu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PAGE
NB100-65338
Species: Hu, Po, Ca, Pm
Applications: Flow, IHC, IHC-Fr, IP
H00002212-B01P
Species: Hu
Applications: WB

Publications for Fc gamma RIIA/CD32a Antibody (H00002212-B01P) (0)

There are no publications for Fc gamma RIIA/CD32a Antibody (H00002212-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Fc gamma RIIA/CD32a Antibody (H00002212-B01P) (0)

There are no reviews for Fc gamma RIIA/CD32a Antibody (H00002212-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Fc gamma RIIA/CD32a Antibody (H00002212-B01P). (Showing 1 - 1 of 1 FAQ).

  1. Does any of your FCGR2A antibodies (19C10, 6D11, 13G9) cross react to FCGR2B?
    • For these antibodies, we have used the full-length protein FCGR2A (NP_067674) as the immunogen and we have not mapped the epitope that is detected with each Ab yet. I did an alignment of these two proteins and they are highly conserved thus it seems likely that there will be cross-reactivity.

Secondary Antibodies

 

Isotype Controls

Additional Fc gamma RIIA/CD32a Products

Bioinformatics Tool for Fc gamma RIIA/CD32a Antibody (H00002212-B01P)

Discover related pathways, diseases and genes to Fc gamma RIIA/CD32a Antibody (H00002212-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Fc gamma RIIA/CD32a Antibody (H00002212-B01P)

Discover more about diseases related to Fc gamma RIIA/CD32a Antibody (H00002212-B01P).
 

Pathways for Fc gamma RIIA/CD32a Antibody (H00002212-B01P)

View related products by pathway.

PTMs for Fc gamma RIIA/CD32a Antibody (H00002212-B01P)

Learn more about PTMs related to Fc gamma RIIA/CD32a Antibody (H00002212-B01P).

Blogs on Fc gamma RIIA/CD32a

There are no specific blogs for Fc gamma RIIA/CD32a, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Fc gamma RIIA/CD32a Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FCGR2A
Entrez
Uniprot