FBXO11 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: FBXO11 Antibody [NBP1-84712] - Staining of human cell line A-431 shows positivity in nucleus and nucleoli.
Immunohistochemistry-Paraffin: FBXO11 Antibody [NBP1-84712] - Staining of human lung shows strong cytoplasmic positivity in alveolar type II cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FBXO11 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GHRAKRARVSGKSQDLSAAPAEQYLQEKLPDEVVLKIFSYLLEQDLCRAACVCKRFSELANDPILWKRLYMEVFEYTRPMMHPEPGKFYQINPEEYEHPNPWKESFQQLYKGAHVKPGFAEHFYSNPARYKGR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FBXO11
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FBXO11 Recombinant Protein Antigen (NBP1-84712PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FBXO11 Antibody

  • F-box only protein 11
  • F-box protein 11
  • FBX11MGC44383
  • FLJ12673
  • PRMT9VIT1protein arginine N-methyltransferase 9
  • ubiquitin protein ligase E3 component n-recognin 6
  • UBR6
  • VIT-1
  • Vitiligo-associated protein 1
  • vitiligo-associated protein VIT-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
AF6235
Species: Hu
Applications: WB
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-86253
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-329
Species: Hu
Applications: WB, IHC, IP, PLA, RIA
NB120-6125
Species: Hu, Bv, Ca, Pm, Xp, Dr(-), Mu(-)
Applications: WB, ELISA, Flow, ICC/IF, IP, MiAr, CyTOF-ready
NB120-1868
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP2-54692
Species: Hu, Mu, Rt
Applications: WB, IHC-P
NB100-56681
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC-P
NB100-122
Species: Hu, Mu, Rt, Fi, Ha, Pm, Sh
Applications: WB, Simple Western, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO
NBP1-55113
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-01438
Species: Hu
Applications: WB, IHC, IHC-P
NB300-130
Species: Hu, Mu, Rt, Bv, Ce, Ch, Dr, Pl
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
H00007444-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, RNAi
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
NBP1-84712
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for FBXO11 Antibody (NBP1-84712) (0)

There are no publications for FBXO11 Antibody (NBP1-84712).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FBXO11 Antibody (NBP1-84712) (0)

There are no reviews for FBXO11 Antibody (NBP1-84712). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FBXO11 Antibody (NBP1-84712) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FBXO11 Products

Bioinformatics Tool for FBXO11 Antibody (NBP1-84712)

Discover related pathways, diseases and genes to FBXO11 Antibody (NBP1-84712). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FBXO11 Antibody (NBP1-84712)

Discover more about diseases related to FBXO11 Antibody (NBP1-84712).
 

Pathways for FBXO11 Antibody (NBP1-84712)

View related products by pathway.

PTMs for FBXO11 Antibody (NBP1-84712)

Learn more about PTMs related to FBXO11 Antibody (NBP1-84712).

Blogs on FBXO11

There are no specific blogs for FBXO11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FBXO11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FBXO11