UBR1 Antibody (2F5)

Images

 
Western Blot: UBR1 Antibody (2F5) [H00197131-M01] - UBR1 monoclonal antibody (M01), clone 2F5 Analysis of UBR1 expression in Hela S3 NE.
Sandwich ELISA: UBR1 Antibody (2F5) [H00197131-M01] - Detection limit for recombinant GST tagged UBR1 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-Fr, S-ELISA
Clone
2F5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

UBR1 Antibody (2F5) Summary

Immunogen
UBR1 (NP_777576, 2 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ADEEAGGTERMEISAELPQTPQRLASWWDQQVDFYTAFLHHLAQLVPEIYFAEMDPDLEKQEESVQMSIFTPLEWYLFGEDPDICLEKLKHSGAFQLCG
Specificity
UBR1 - ubiquitin protein ligase E3 component n-recognin 1
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
UBR1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Frozen
  • Sandwich ELISA
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.
Publications
Read Publications using H00197131-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for UBR1 Antibody (2F5)

  • E3 ubiquitin-protein ligase UBR1
  • E3a ligase
  • EC 6.3.2.-
  • JBS
  • MGC142065
  • MGC142067
  • N-recognin-1
  • ubiquitin ligase E3 alpha-I
  • ubiquitin protein ligase E3 component n-recognin 1
  • ubiquitin-protein ligase E3-alpha
  • Ubiquitin-protein ligase E3-alpha-1
  • Ubiquitin-protein ligase E3-alpha-I

Background

The N-end rule pathway is one proteolytic pathway of the ubiquitin system. The recognition component of this pathway, encoded by this gene, binds to a destabilizing N-terminal residue of a substrate protein and participates in the formation of a substrate-linked multiubiquitin chain. This leads to the eventual degradation of the substrate protein. The protein described in this record has a RING-type zinc finger and a UBR-type zinc finger. Mutations in this gene have been associated with Johanson-Blizzard syndrome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-45243
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB100-553
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1591
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, KD
NBP2-45731
Species: Hu, Ca, Pm
Applications: WB, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-31361
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
H00056852-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, RNAi
NBP2-76836
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-67232
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-28730
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-89134
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for UBR1 Antibody (H00197131-M01)(2)

Reviews for UBR1 Antibody (H00197131-M01) (0)

There are no reviews for UBR1 Antibody (H00197131-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for UBR1 Antibody (H00197131-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional UBR1 Products

Bioinformatics Tool for UBR1 Antibody (H00197131-M01)

Discover related pathways, diseases and genes to UBR1 Antibody (H00197131-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UBR1 Antibody (H00197131-M01)

Discover more about diseases related to UBR1 Antibody (H00197131-M01).
 

Pathways for UBR1 Antibody (H00197131-M01)

View related products by pathway.

PTMs for UBR1 Antibody (H00197131-M01)

Learn more about PTMs related to UBR1 Antibody (H00197131-M01).

Blogs on UBR1

There are no specific blogs for UBR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UBR1 Antibody (2F5) and receive a gift card or discount.

Bioinformatics

Gene Symbol UBR1
Entrez
OMIM
Uniprot