VRK2 Antibody (3B10)

Images

 
Western Blot: VRK2 Antibody (3B10) [H00007444-M01] - VRK2 monoclonal antibody (M01), clone 3B10 Analysis of VRK2 expression in K-562.
Immunocytochemistry/ Immunofluorescence: VRK2 Antibody (3B10) [H00007444-M01] - Analysis of monoclonal antibody to VRK2 on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: VRK2 Antibody (3B10) [H00007444-M01] - Analysis of VRK2 over-expressed 293 cell line, cotransfected with VRK2 Validated Chimera RNAi ( Cat # H00007444-R01V ) (Lane 2) or non-transfected control (Lane 1). ...read more
Western Blot: VRK2 Antibody (3B10) [H00007444-M01] - VRK2 monoclonal antibody (M01), clone 3B10. Analysis of VRK2 expression in U-2 OS.
Western Blot: VRK2 Antibody (3B10) [H00007444-M01] - Analysis of VRK2 expression in transfected 293T cell line by VRK2 monoclonal antibody (M01), clone 3B10.Lane 1: VRK2 transfected lysate(58.1 KDa).Lane 2: ...read more
Sandwich ELISA: VRK2 Antibody (3B10) [H00007444-M01] - Detection limit for recombinant GST tagged VRK2 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, S-ELISA, KD
Clone
3B10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

VRK2 Antibody (3B10) Summary

Immunogen
VRK2 (AAH27854, 260 a.a. ~ 360 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VQTAKTNLLDELPQSVLKWAPSGSSCCEIAQFLVCAHSLAYDEKPNYQALKKILNPHGIPLGPLDFSTKGQSINVHTPNSQKVDSQKAATKQVNKAHNRLI
Specificity
VRK2 - vaccinia related kinase 2
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
VRK2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Knockdown Validated
  • Sandwich ELISA
  • Western Blot
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, RNAi Validation and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for VRK2 Antibody (3B10)

  • EC 2.7.11.1
  • serine/threonine-protein kinase VRK2
  • vaccinia related kinase 2
  • vaccinia virus B1R-related kinase 2
  • Vaccinia-related kinase 2
  • vaccinia-related kinase-2

Background

This gene encodes a member of the vaccinia-related kinase (VRK) family of serine/threonine protein kinases. This gene is widely expressed in human tissues and has increased expression in actively dividing cells, such as those in testis, leukocytes, fetal liver, and carcinomas. Its protein localizes to the endoplasmic reticulum and has been shown to phosphorylate casein and undergo autophosphorylation. While several transcript variants may exist for this gene, the full-length nature of only one has been biologically validated to date.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85822
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-57871
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-58572
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00008815-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NB100-56681
Species: Hu, Mu, Rb, Rt, Sh
Applications: ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
NB100-122
Species: Fi, Ha, Hu, Mu, Pm, Rb, Rt, Re, Sh
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, KO, PAGE, Simple Western, WB
NBP2-67358
Species: Bv, Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-55113
Species: Hu, Pm, Mu
Applications: IHC, IHC-P, WB
NB100-59826
Species: Hu, Mu
Applications: ICC/IF, IP, KO, Simple Western, WB
NLS799
Species: Hu
Applications: IHC, IHC-P, WB
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
NBP3-04958
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
236-EG
Species: Hu
Applications: BA
AF4366
Species: Hu, Mu, Rt
Applications: WB
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
H00728695-B01P
Species: Hu
Applications: ICC/IF, IP, WB
NBP1-88927
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for VRK2 Antibody (H00007444-M01) (0)

There are no publications for VRK2 Antibody (H00007444-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VRK2 Antibody (H00007444-M01) (0)

There are no reviews for VRK2 Antibody (H00007444-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for VRK2 Antibody (H00007444-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional VRK2 Products

Bioinformatics Tool for VRK2 Antibody (H00007444-M01)

Discover related pathways, diseases and genes to VRK2 Antibody (H00007444-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VRK2 Antibody (H00007444-M01)

Discover more about diseases related to VRK2 Antibody (H00007444-M01).
 

Pathways for VRK2 Antibody (H00007444-M01)

View related products by pathway.

PTMs for VRK2 Antibody (H00007444-M01)

Learn more about PTMs related to VRK2 Antibody (H00007444-M01).
 

Research Areas for VRK2 Antibody (H00007444-M01)

Find related products by research area.

Blogs on VRK2

There are no specific blogs for VRK2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our VRK2 Antibody (3B10) and receive a gift card or discount.

Bioinformatics

Gene Symbol VRK2
Entrez
OMIM
Uniprot