FBXO11 Antibody - BSA Free

Western Blot: FBXO11 Antibody [NBP1-55066] - Sample Tissue: Human Ovary Tumor Antibody Dilution: 1.0 ug/ml

Chromatin Immunoprecipitation: FBXO11 Antibody [NBP1-55066] - Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.

Western Blot: FBXO11 Antibody [NBP1-55066] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:62500 Positive Control: 293T cell lysate FBXO11 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells

• Reactivity: Hu
• Applications: WB, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

FBXO11 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to FBXO11(F-box protein 11) The peptide sequence was selected from the middle region of FBXO11 (NP_079409). Peptide sequence HDVEFIRHDRFFCDCGAGTLSNPCTLAGEPTHDTDTLYDSAPPIESNTLQ. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FBXO11
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation (ChIP)
  • Western Blot 1.0 ug/ml
• Theoretical MW: 94 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for FBXO11 Antibody - BSA Free

• F-box only protein 11
• F-box protein 11
• FBX11MGC44383
• FLJ12673
• PRMT9VIT1protein arginine N-methyltransferase 9
• ubiquitin protein ligase E3 component n-recognin 6
• UBR6
• VIT-1
• Vitiligo-associated protein 1
• vitiligo-associated protein VIT-1

Background

FBXO11 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. Alternatively spliced transcript variants encoding distinct isoforms have been identified for FBXO11.This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. Alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FBXO11 Antibody (NBP1-55066)(1)

Publication using NBP1-55066

• Lee,MJ. Proc. Natl. Acad. Sci. U.S.A. 105 (1), 100-105. 2008-01-01 [PMID: 18162545]

Bioinformatics

• Gene Symbol: FBXO11
• Entrez:
  • 80204(Human)
  • 301674(Rat)
• Uniprot:
  • Q86XK2(Human)