Fbx32 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Fbx32 Antibody [NBP2-57070] - Staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.

• Reactivity: Hu, Mu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Fbx32 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Fbx32 Antibody - BSA Free (NBP2-57070) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PGQNWVKTADGWKRFLDEKSGSFVSDLSSYCNKEVYNKENLFNSLNYDVAAKKRKKDMLNSK
• Predicted Species: Mouse (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FBXO32
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Fbx32 Recombinant Protein Antigen (NBP2-57070PEP)

Reactivity Notes

Rat 85%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Fbx32 Antibody - BSA Free

• atrogin 1
• ATROGIN1
• atrogin-1
• F-box only protein 32
• F-box protein 32
• Fbx32
• FLJ32424
• MAFBX
• MAFbxMGC33610
• Muscle atrophy F-box protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FBXO32