Fbx32 Antibody


Immunocytochemistry/ Immunofluorescence: Fbx32 Antibody [NBP2-57070] - Staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications ICC/IF

Order Details

Fbx32 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PGQNWVKTADGWKRFLDEKSGSFVSDLSSYCNKEVYNKENLFNSLNYDVAAKKRKKDMLNSK
Specificity of human Fbx32 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Fbx32 Recombinant Protein Antigen (NBP2-57070PEP)

Reactivity Notes

Rat 85%

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for Fbx32 Antibody

  • atrogin 1
  • atrogin-1
  • F-box only protein 32
  • F-box protein 32
  • Fbx32
  • FLJ32424
  • MAFbxMGC33610
  • Muscle atrophy F-box protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, Simple Western
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu, Sq
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, ICFlow
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, KO

Publications for Fbx32 Antibody (NBP2-57070) (0)

There are no publications for Fbx32 Antibody (NBP2-57070).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Fbx32 Antibody (NBP2-57070) (0)

There are no reviews for Fbx32 Antibody (NBP2-57070). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Fbx32 Antibody (NBP2-57070) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for Fbx32 Antibody (NBP2-57070)

Discover related pathways, diseases and genes to Fbx32 Antibody (NBP2-57070). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Fbx32 Antibody (NBP2-57070)

Discover more about diseases related to Fbx32 Antibody (NBP2-57070).

Pathways for Fbx32 Antibody (NBP2-57070)

View related products by pathway.

PTMs for Fbx32 Antibody (NBP2-57070)

Learn more about PTMs related to Fbx32 Antibody (NBP2-57070).

Blogs on Fbx32

There are no specific blogs for Fbx32, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Fbx32 Antibody and receive a gift card or discount.


Gene Symbol FBXO32