FBRS Antibody

Images

 
Western Blot: FBRS Antibody [NBP2-82760] - Host: Rabbit. Target Name: FBRS. Sample Tissue: Human Jurkat Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FBRS Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human FBRS. Peptide sequence: ASPPDPWGRLHRSPLTFPAWVRPPEAARTPGSDKERPVERREPSITKEEK The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
FBRS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FBRS Antibody

  • FBS
  • FBS1
  • fibrogenic lymphokine
  • fibrosin 1
  • fibrosin
  • FLJ11618
  • probable fibrosin-1 long transcript protein
  • probable fibrosin-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

236-EG
Species: Hu
Applications: BA
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
233-FB/CF
Species: Hu
Applications: BA
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
D6050
Species: Hu
Applications: ELISA
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
2914-HT
Species: Hu
Applications: BA
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
255-SC/CF
Species: Hu
Applications: BA
7954-GM/CF
Species: Hu
Applications: BA
DVE00
Species: Hu
Applications: ELISA
203-IL/CF
Species: Hu
Applications: BA
MEP00B
Species: Mu
Applications: ELISA
7954-GM/CF
Species: Hu
Applications: BA
MAB1419
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP2-82760
Species: Hu
Applications: WB

Publications for FBRS Antibody (NBP2-82760) (0)

There are no publications for FBRS Antibody (NBP2-82760).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FBRS Antibody (NBP2-82760) (0)

There are no reviews for FBRS Antibody (NBP2-82760). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FBRS Antibody (NBP2-82760) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FBRS Products

Array NBP2-82760

Bioinformatics Tool for FBRS Antibody (NBP2-82760)

Discover related pathways, diseases and genes to FBRS Antibody (NBP2-82760). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FBRS Antibody (NBP2-82760)

Discover more about diseases related to FBRS Antibody (NBP2-82760).
 

Pathways for FBRS Antibody (NBP2-82760)

View related products by pathway.

Blogs on FBRS

There are no specific blogs for FBRS, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FBRS Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FBRS