FBPase 1 Antibody (7N8C1)

Western Blot: FBPase 1 Antibody (7N8C1) [NBP3-15423] - Western blot analysis of extracts of MCF7 cells, using FBPase 1 Rabbit mAb (NBP3-15423) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 5s.

Immunocytochemistry/Immunofluorescence: FBPase 1 Antibody (7N8C1) [NBP3-15423] - Immunofluorescence analysis of HeLa cells using FBPase 1 Rabbit mAb (NBP3-15423) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunohistochemistry: FBPase 1 Antibody (7N8C1) [NBP3-15423] - Immunofluorescence analysis of mouse kidney using FBPase 1 Rabbit mAb (NBP3-15423) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunohistochemistry-Paraffin: FBPase 1 Antibody (7N8C1) [NBP3-15423] - Immunohistochemistry of paraffin-embedded human liver cancer using FBPase 1 Rabbit mAb (NBP3-15423) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: FBPase 1 Antibody (7N8C1) [NBP3-15423] - Immunohistochemistry of paraffin-embedded mouse kidney using FBPase 1 Rabbit mAb (NBP3-15423) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: FBPase 1 Antibody (7N8C1) [NBP3-15423] - Immunohistochemistry of paraffin-embedded rat kidney using FBPase 1 Rabbit mAb (NBP3-15423) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry: FBPase 1 Antibody (7N8C1) [NBP3-15423] - Immunofluorescence analysis of rat kidney using FBPase 1 Rabbit mAb (NBP3-15423) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: FBPase 1 Antibody (7N8C1) [FBPase 1] - Immunofluorescence analysis of paraffin-embedded mouse kidney using FBPase 1 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: FBPase 1 Antibody (7N8C1) [FBPase 1] - Immunofluorescence analysis of paraffin-embedded rat kidney using FBPase 1 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clone: 7N8C1
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

FBPase 1 Antibody (7N8C1) Summary

• Description: Novus Biologicals Rabbit FBPase 1 Antibody (7N8C1) (NBP3-15423) is a recombinant monoclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 239-338 of human FBPase 1 (P09467). APYGARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHSAQ
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: FBP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for FBPase 1 Antibody (7N8C1)

• D-fructose-1,6-bisphosphate 1-phosphohydrolase 1
• EC 3.1.3
• EC 3.1.3.11
• FBP
• FBP1
• FBPase 1
• fructose-1,6-bisphosphatase 1
• fructose-bisphosphatase 1
• growth-inhibiting protein 17

Background

Fructose-1,6-bisphosphatase 1, a gluconeogenesis regulatory enzyme, catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate and inorganic phosphate. Fructose-1,6-diphosphatase deficiency is associated with hypoglycemia and metabolic acidosis. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FBP1