![Western Blot: FBP2 Antibody [NBP1-56453] - Analysis of FBP2 in 20ul of total soluble sarcoplasmic proteins from European bass (Dicentrarchus labrax) using FBP2 antibody (NBP1-56453). Image from verified customer review.](http://images.novusbio.com/fullsize/FBP2-Antibody-Western-Blot-NBP1-56453-img0003.jpg "Western Blot: FBP2 Antibody [NBP1-56453] - Analysis of FBP2 in 20ul of total soluble sarcoplasmic proteins from European bass (Dicentrarchus labrax) using FBP2 antibody (NBP1-56453). Image from verified customer review.")
| Reactivity | Hu, FiSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Concentration | 0.5 mg/ml |
| Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen | Synthetic peptides corresponding to FBP2(fructose-1,6-bisphosphatase 2) The peptide sequence was selected from the middle region of FBP2. Peptide sequence YAKYFDAATTEYVQKKKFPEDGSAPYGARYVGSMVADVHRTLVYGGIFLY. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | FBP2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Reviewed Applications |
|
|
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
![Flow Cytometry FOLR1 Antibody (548908) [Unconjugated]](https://images.novusbio.com/images2/FOLR1_MAB5646_Flow_Cytometry_10781.jpg)
![Western Blot FOLR1 Antibody (548908) [Unconjugated]](https://images.novusbio.com/images2/FOLR1_MAB5646_Western_Blot_6248.jpg)
![Immunocytochemistry FOLR1 Antibody (548908) [Unconjugated]](https://images.novusbio.com/images2/FOLR1_MAB5646_Immunocytochemistry_6624.jpg)
![Immunohistochemistry Neurophysin II/Arg-vasopressin Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af009_human-neurophysin-ii-affinity-purified-polyclonal-ab-immunohistochemistry-2812202013195.jpg)
| Publication using NBP1-56453 | Applications | Species |
|---|---|---|
| Bakshi I, Suryana E, Small L et al. Fructose bisphosphatase 2 overexpression increases glucose uptake in skeletal muscle. J Endocrinol 2018-05-01 [PMID: 29507044] |
| Images | Ratings | Applications | Species | Date | Details | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
ARSENIOS ZAFEIRIOS LOUKISSAS |
WB | European bass (Dicentrarchus labrax) and Fish | 01/04/2022 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
Research Areas for FBP2 Antibody (NBP1-56453)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
| ARSENIOS ZAFEIRIOS LOUKISSAS 01/04/2022 |
||
| Application: | WB | |
| Species: | European bass (Dicentrarchus labrax) and Fish |
![Western Blot: FBP2 Antibody [NBP1-56453] - Human Muscle lysate, concentration 0.2-1 ug/ml.](http://images.novusbio.com/fullsize/FBP2-Antibody-Western-Blot-NBP1-56453-img0002.jpg "Western Blot: FBP2 Antibody [NBP1-56453] - Human Muscle lysate, concentration 0.2-1 ug/ml.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
