FBN3 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the amino acids: LCQGGSCVNMVGSFHCRCPVGHRLSDSSAACEDYRAGACFSVLFGGRCAGDLAGHYTRRQCCC |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
FBN3 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for FBN3 Antibody - BSA Free
Background
The FBN3 gene encodes a protein that belongs to the fibrillin gene family. Fibrillins are extracellular matrix moleculesthat assemble into microfibrils in many connective tissues. This gene is most highly expressed in fetal tissues andits protein product is l
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-Fr, IHC-P, WB
Species: Bv, Fe, Hu, Rb
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: AP, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: BA
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
Species: Hu
Applications: ELISA, ICC/IF, IP, S-ELISA, WB
Species: Hu
Applications: Block, IHC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: IP, WB
Species: Hu, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Publications for FBN3 Antibody (NBP2-14010) (0)
There are no publications for FBN3 Antibody (NBP2-14010).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for FBN3 Antibody (NBP2-14010) (0)
There are no reviews for FBN3 Antibody (NBP2-14010).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for FBN3 Antibody (NBP2-14010) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional FBN3 Products
Blogs on FBN3