FBN3 Antibody

Images

 
Immunohistochemistry-Paraffin: FBN3 Antibody [NBP2-14010] Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FBN3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LCQGGSCVNMVGSFHCRCPVGHRLSDSSAACEDYRAGACFSVLFGGRCAG DLAGHYTRRQCCC
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FBN3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FBN3 Protein (NBP2-14010PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FBN3 Antibody

  • fibrillin 3
  • fibrillin-3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-8146
Species: Hu, Po, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IM
NBP1-88169
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P, ISH
NB100-2076
Species: Hu, Po, Ca, Fe, Gt, GP, Sh
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
H00006934-M06
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
MAB388
Species: Hu
Applications: WB, AP
AF3850
Species: Hu
Applications: WB
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-25198
Species: Hu
Applications: Flow, IP, Flow-CS
NBP2-47279
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
AF340
Species: Hu
Applications: WB, IHC, Block
NB120-11012
Species: Hu, Bv(-), Ca(-), Eq(-), Gp(-), Mu(-), Po(-)
Applications: WB, ELISA, ICC/IF, IP
NBP1-77300
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF6295
Species: Hu, Mu
Applications: WB, IHC
AF2487
Species: Hu
Applications: WB, IP
NB100-1596
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-14226
Species: Hu
Applications: IHC, IHC-P
NBP2-14010
Species: Hu
Applications: IHC, IHC-P

Publications for FBN3 Antibody (NBP2-14010) (0)

There are no publications for FBN3 Antibody (NBP2-14010).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FBN3 Antibody (NBP2-14010) (0)

There are no reviews for FBN3 Antibody (NBP2-14010). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FBN3 Antibody (NBP2-14010) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FBN3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FBN3