FBN3 Antibody - BSA Free

Immunohistochemistry-Paraffin: FBN3 Antibody [NBP2-14010] Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FBN3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: LCQGGSCVNMVGSFHCRCPVGHRLSDSSAACEDYRAGACFSVLFGGRCAGDLAGHYTRRQCCC
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FBN3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  FBN3 Protein (NBP2-14010PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for FBN3 Antibody - BSA Free

• fibrillin 3
• fibrillin-3

Background

The FBN3 gene encodes a protein that belongs to the fibrillin gene family. Fibrillins are extracellular matrix moleculesthat assemble into microfibrils in many connective tissues. This gene is most highly expressed in fetal tissues andits protein product is l

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FBN3