MEGF11 Antibody


Western Blot: MEGF11 Antibody [NBP1-91360] - Titration: 0.2-1 ug/ml, Positive Control: Human Muscle.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

MEGF11 Antibody Summary

Synthetic peptide directed towards the middle region of human MEGF11. Peptide sequence LMMEELNPYTKISPALGAERHSVGAVTGIMLLLFLIVVLLGLFAWHRRRQ.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against MEGF11 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MEGF11 Antibody

  • DKFZp434L121
  • KIAA1781
  • multiple EGF-like domains protein 11
  • multiple EGF-like-domains 11
  • multiple epidermal growth factor-like domains protein 11


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB

Publications for MEGF11 Antibody (NBP1-91360) (0)

There are no publications for MEGF11 Antibody (NBP1-91360).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MEGF11 Antibody (NBP1-91360) (0)

There are no reviews for MEGF11 Antibody (NBP1-91360). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MEGF11 Antibody (NBP1-91360) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for MEGF11 Antibody (NBP1-91360)

Discover related pathways, diseases and genes to MEGF11 Antibody (NBP1-91360). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MEGF11 Antibody (NBP1-91360)

Discover more about diseases related to MEGF11 Antibody (NBP1-91360).

Pathways for MEGF11 Antibody (NBP1-91360)

View related products by pathway.

Blogs on MEGF11

There are no specific blogs for MEGF11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MEGF11 Antibody and receive a gift card or discount.


Gene Symbol MEGF11