FATP1/SLC27A1 Antibody (2G9) - Azide and BSA Free Summary
| Description |
Novus Biologicals Mouse FATP1/SLC27A1 Antibody (2G9) - Azide and BSA Free (H00376497-M03) is a monoclonal antibody validated for use in ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
SLC27A1 (NP_940982.1, 44 a.a. ~ 137 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LRIVCKTARRDLFGLSVLIRVRLELRRHQRAGHTIPRIFQAVVQRQPERLALVDAGTGECWTFAQLDAYSNAVANLFRQLGFAPGDVVAIFLEG |
| Specificity |
SLC27A1 - solute carrier family 27 (fatty acid transporter), member 1 (2G9) |
| Isotype |
IgG2a Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
SLC27A1 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This product is useful for ELISA. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for FATP1/SLC27A1 Antibody (2G9) - Azide and BSA Free
Background
SLC27A1 is involved in translocation of long-chain fatty acids (LFCA) across the plasma membrane. The LFCA importappears to be hormone-regulated in a tissue-specific manner. In adipocytes, but not myocytes, insulin induces a rapidtranslocation of FATP1 from intracel
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Av, Bv, Hu, Mu, Po, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
Species: Hu
Applications: WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
Species: Hu, Mu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu
Applications: ELISA
Publications for FATP1/SLC27A1 Antibody (H00376497-M03) (0)
There are no publications for FATP1/SLC27A1 Antibody (H00376497-M03).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for FATP1/SLC27A1 Antibody (H00376497-M03) (0)
There are no reviews for FATP1/SLC27A1 Antibody (H00376497-M03).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for FATP1/SLC27A1 Antibody (H00376497-M03) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional FATP1/SLC27A1 Products
Blogs on FATP1/SLC27A1