FANCB Antibody

Images

 
Immunohistochemistry-Paraffin: FANCB Antibody [NBP1-84757] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FANCB Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DSLNSDCLTSFKITDLGKINYSSEPSDCNEDDLFEDKQENRYLVVPPLETGLKVCFSSFRELRQHLLLKEKIISKSYKALINLVQGKDDNTSSAEEKECLVPLCGEEENSVHILDEKLSDNFQDSEQLVEKIWY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FANCB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FANCB Protein (NBP1-84757PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FANCB Antibody

  • EC 2.8.1
  • EC 3.6.3.14
  • FA2
  • FAAP90
  • FAAP95FAB
  • FACB
  • Fanconi anemia group B protein
  • Fanconi anemia, complementation group B
  • Fanconi anemia-associated polypeptide of 95 kDa
  • FLJ34064
  • Protein FACB

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00171023-M05
Species: Hu
Applications: WB, ELISA
NBP1-87769
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89827
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IF
NB100-55256
Species: Hu
Applications: WB, IHC-P, IP
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP2-22377
Species: Hu
Applications: WB, IHC, IHC-P
AF3667
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
NBP2-33855
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF972
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-31368
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92025
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00027130-P02
Species: Hu
AF7579
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP2-15771
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-84757
Species: Hu
Applications: IHC, IHC-P

Publications for FANCB Antibody (NBP1-84757) (0)

There are no publications for FANCB Antibody (NBP1-84757).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FANCB Antibody (NBP1-84757) (0)

There are no reviews for FANCB Antibody (NBP1-84757). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FANCB Antibody (NBP1-84757) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FANCB Products

Bioinformatics Tool for FANCB Antibody (NBP1-84757)

Discover related pathways, diseases and genes to FANCB Antibody (NBP1-84757). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FANCB Antibody (NBP1-84757)

Discover more about diseases related to FANCB Antibody (NBP1-84757).
 

Pathways for FANCB Antibody (NBP1-84757)

View related products by pathway.

PTMs for FANCB Antibody (NBP1-84757)

Learn more about PTMs related to FANCB Antibody (NBP1-84757).

Blogs on FANCB.

Fanconi Antibodies and Cancer Research
We at Novus Biologicals have an extensive antibody databasedevoted to the 13 Fanconi anaemia complementation (FANC) genes, which are involved in the recognition and repair of damaged DNA.The core complex of 8 proteins (FANCA, B, C, E, F, G, L and M)...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FANCB Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FANCB