FAM62A Antibody - BSA Free

Western Blot: FAM62A Antibody [NBP3-35546] - Western blot analysis of various lysates using FAM62A Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 5s.

Immunocytochemistry/ Immunofluorescence: FAM62A Antibody [NBP3-35546] - Immunofluorescence analysis of U-2 OS cells using FAM62A Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FAM62A Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit FAM62A Antibody - BSA Free (NBP3-35546) is a polyclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 90-220 of human FAM62A (NP_056107.1).
  
  Sequence:
  GWRRVRDEKERSLRAARQLLDDEEQLTAKTLYMSHRELPAWVSFPDVEKAEWLNKIVAQVWPFLGQYMEKLLAETVAPAVRGSNPHLQTFTFTRVELGEKPLRIIGVKVHPGQRKEQILLDLNISYVGDVQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FAM62A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:200 - 1:2000
• Theoretical MW: 123 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for FAM62A Antibody - BSA Free

• E-Syt1
• extended synaptotagmin-like protein 1
• family with sequence similarity 62 (C2 domain containing), member A
• KIAA0747FAM62A
• MBC2extended synaptotagmin-1
• Membrane-bound C2 domain-containing protein

Background

FAM62A belongs to the extended synaptotagmin family. It may play a role as a calcium-regulated intrinsic membrane protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FAM62A