FAM3D Antibody

Images

 
Immunohistochemistry: FAM3D Antibody [NBP2-30933] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAM3D Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PCPANYFAFKICSGAANVVGPTMCFEDRMIMSPVKNNVGRGLNIALVNGTTGAVLGQKAFDMYSGDVMHLVKFLKEIPGGALVLVASYDDPGTKMNDESRKLFSDLGSSYAKQLGFRD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FAM3D
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FAM3D Protein (NBP2-30933PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FAM3D Antibody

  • cytokine-like protein EF-7
  • EF7
  • FAM3D
  • family with sequence similarity 3, member D
  • OIT1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-1182
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
AF1227
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NB100-1888
Species: Hu, Mu, Rt
Applications: WB, IHC, PEP-ELISA
H00007103-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
H00054600-B01P
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
AF3080
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-32841
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76514
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-24464
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC-P
NBP1-32899
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-06542
Species: Hu
Applications: WB, IHC, IHC-P, IP
H00054097-M07
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
AF2865
Species: Hu
Applications: WB
NBP1-92201
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33084
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-317
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-14006
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30933
Species: Hu
Applications: IHC, IHC-P

Publications for FAM3D Antibody (NBP2-30933) (0)

There are no publications for FAM3D Antibody (NBP2-30933).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM3D Antibody (NBP2-30933) (0)

There are no reviews for FAM3D Antibody (NBP2-30933). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FAM3D Antibody (NBP2-30933) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FAM3D Products

Bioinformatics Tool for FAM3D Antibody (NBP2-30933)

Discover related pathways, diseases and genes to FAM3D Antibody (NBP2-30933). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FAM3D Antibody (NBP2-30933)

Discover more about diseases related to FAM3D Antibody (NBP2-30933).
 

Pathways for FAM3D Antibody (NBP2-30933)

View related products by pathway.

Research Areas for FAM3D Antibody (NBP2-30933)

Find related products by research area.

Blogs on FAM3D

There are no specific blogs for FAM3D, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM3D Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FAM3D
Entrez
Uniprot