![Immunohistochemistry-Paraffin: FAM3D Antibody [NBP2-30933] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/FAM3D-Antibody-Immunohistochemistry-Paraffin-NBP2-30933-img0001.jpg "Immunohistochemistry-Paraffin: FAM3D Antibody [NBP2-30933] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit FAM3D Antibody - BSA Free (NBP2-30933) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PCPANYFAFKICSGAANVVGPTMCFEDRMIMSPVKNNVGRGLNIALVNGTTGAVLGQKAFDMYSGDVMHLVKFLKEIPGGALVLVASYDDPGTKMNDESRKLFSDLGSSYAKQLGFRD |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | FAM3D |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry A33/GPA33 Antibody [Unconjugated]](https://images.novusbio.com/images2/A33_AF3080_Immunohistochemistry_6771.jpg)
![Flow Cytometry A33/GPA33 Antibody [Unconjugated]](https://images.novusbio.com/images2/A33_AF3080_Flow_Cytometry_8193.jpg)
![Western Blot A33/GPA33 Antibody [Unconjugated]](https://images.novusbio.com/images2/af3080_human-a33-affinity-purified-polyclonal-ab-western-blot-2582021113759.jpg)
![FAM3A Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "FAM3A Antibody [Unconjugated]")
Secondary Antibodies |
Isotype Controls |
Research Areas for FAM3D Antibody (NBP2-30933)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Flow Cytometry EpCAM/TROP1 Antibody [Unconjugated]](https://images.novusbio.com/images2/EpCAM_AF960_Flow_Cytometry_15685.jpg)
![Immunohistochemistry EpCAM/TROP1 Antibody [Unconjugated]](https://images.novusbio.com/images2/EpCAM_AF960_Immunohistochemistry_23512.jpg)
![Immunohistochemistry EpCAM/TROP1 Antibody [Unconjugated]](https://images.novusbio.com/images2/EpCAM_AF960_Immunohistochemistry_23513.jpg)
![Immunohistochemistry Galectin-4 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af2128_mouse-galectin-4-affinity-purified-polyclonal-ab-immunohistochemistry-29122022154254.jpg)
![SDS-PAGE BMP-4 [Unconjugated]](https://images.novusbio.com/images2/BMP-4_314-BP_100.jpg)
![Bioactivity BMP-4 [Unconjugated]](https://images.novusbio.com/images2/314-bp_recombinant-human-bmp-4-protein-1882021123744.jpg)
![Western Blot TSPAN8/TM4SF3 Antibody (458811) [Unconjugated]](https://images.novusbio.com/images2/TSPAN8_MAB4734_Western_Blot_11031.jpg)
![Flow Cytometry TSPAN8/TM4SF3 Antibody (458811) [Unconjugated]](https://images.novusbio.com/images2/TSPAN8_MAB4734_Flow_Cytometry_8501.jpg)
![Immunocytochemistry TSPAN8/TM4SF3 Antibody (458811) [Unconjugated]](https://images.novusbio.com/images2/TSPAN8_MAB4734_Immunocytochemistry_9894.jpg)
![N/A TFF3 [HRP]](https://images.novusbio.com/images2/TFF3_DTFF30_ELISA_460.jpg)
![N/A TFF3 [HRP]](https://images.novusbio.com/images2/DATA_TFF3_DTFF30_ELISA_840.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")