NSMCE1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: NSMCE1 Antibody [NBP1-92201] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm & vesicles.

Immunohistochemistry-Paraffin: NSMCE1 Antibody [NBP1-92201] - Staining of human rectum shows moderate nuclear positivity in glandular cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NSMCE1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NSMCE1 Antibody - BSA Free (NBP1-92201) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EQYIRETYPDAVKICNICHSLLIQGQSCETCGIRMHLPCVAKYFQSNAEPRCPHCNDYWPHEIPKVFDPEKERESGVLKSNK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NSMCE1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  NSMCE1 Protein (NBP1-92201PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (87%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NSMCE1 Antibody - BSA Free

• non-SMC element 1 homolog (S. cerevisiae)
• Non-SMC element 1 homolog
• non-structural maintenance of chromosomes element 1 homolog
• NSE1

Background

Probable component of the SMC5-SMC6 complex, a complex involved in DNA double-strand breaks by homologousrecombination. The complex may promote sister chromatid homologous recombination by recruiting the SMC1-SMC3 cohesincomplex to double-strand breaks

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NSMCE1