A33/GPA33 Antibody

Images

 
Immunohistochemistry: A33/GPA33 Antibody [NBP1-89332] - Staining of human colon shows distinct cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

A33/GPA33 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TYECSVSLMSDLEGNTKSRVRLLVLVPPSKPECGIEGETIIGNNIQLTCQSKEGSPTPQYSWKRYNILNQEQPLAQPASGQPVSLKNISTDTSGYYICTSSNEEGTQFCNITVA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GPA33
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
A33/GPA33 Protein (NBP1-89332PEP)
Publications
Read Publication using NBP1-89332.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for A33/GPA33 Antibody

  • A33
  • cell surface A33 antigen
  • glycoprotein A33 (transmembrane)
  • Glycoprotein A33
  • GPA33
  • MGC129986
  • MGC129987
  • transmembrane glycoprotein A33

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83552
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00003703-M02
Species: Hu
Applications: WB, ELISA, IHC-P
H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NB100-64775
Species: Hu, Bb, Bv, Pm
Applications: ELISA, Flow, Func, ICC/IF, IHC, IHC-Fr, IP
NBP1-88582
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBL1-11228
Species: Hu
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29931
Species: Hu
Applications: WB, Flow, IHC-P
NB600-1182
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-81074
Species: Hu
Applications: WB, IHC, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00007103-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-76526
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC
AF3027
Species: Mu
Applications: WB

Publications for A33/GPA33 Antibody (NBP1-89332)(1)

Reviews for A33/GPA33 Antibody (NBP1-89332) (0)

There are no reviews for A33/GPA33 Antibody (NBP1-89332). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for A33/GPA33 Antibody (NBP1-89332) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional A33/GPA33 Products

Bioinformatics Tool for A33/GPA33 Antibody (NBP1-89332)

Discover related pathways, diseases and genes to A33/GPA33 Antibody (NBP1-89332). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for A33/GPA33 Antibody (NBP1-89332)

Discover more about diseases related to A33/GPA33 Antibody (NBP1-89332).
 

Pathways for A33/GPA33 Antibody (NBP1-89332)

View related products by pathway.

PTMs for A33/GPA33 Antibody (NBP1-89332)

Learn more about PTMs related to A33/GPA33 Antibody (NBP1-89332).
 

Research Areas for A33/GPA33 Antibody (NBP1-89332)

Find related products by research area.

Blogs on A33/GPA33

There are no specific blogs for A33/GPA33, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our A33/GPA33 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GPA33
Entrez