A33/GPA33 Antibody - BSA Free

Western Blot: A33/GPA33 Antibody [NBP1-89332] - Analysis in human colon tissue.

Immunohistochemistry-Paraffin: A33/GPA33 Antibody [NBP1-89332] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.

Immunohistochemistry-Paraffin: A33/GPA33 Antibody [NBP1-89332] - Staining of human colon shows high expression.

Immunohistochemistry-Paraffin: A33/GPA33 Antibody [NBP1-89332] - Staining of human liver shows low expression as expected.

Immunohistochemistry-Paraffin: A33/GPA33 Antibody [NBP1-89332] - Analysis in human colon and liver tissues using NBP1-89332 antibody. Corresponding GPA33 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: A33/GPA33 Antibody [NBP1-89332] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: A33/GPA33 Antibody [NBP1-89332] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: A33/GPA33 Antibody [NBP1-89332] - Staining of human liver shows no positivity in hepatocytes as expected.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

A33/GPA33 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit A33/GPA33 Antibody - BSA Free (NBP1-89332) is a polyclonal antibody validated for use in IHC and WB. Anti-A33/GPA33 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TYECSVSLMSDLEGNTKSRVRLLVLVPPSKPECGIEGETIIGNNIQLTCQSKEGSPTPQYSWKRYNILNQEQPLAQPASGQPVSLKNISTDTSGYYICTSSNEEGTQFCNITVA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GPA33
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  A33/GPA33 Protein (NBP1-89332PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for A33/GPA33 Antibody - BSA Free

• A33
• cell surface A33 antigen
• glycoprotein A33 (transmembrane)
• Glycoprotein A33
• GPA33
• MGC129986
• MGC129987
• transmembrane glycoprotein A33

Background

The glycoprotein encoded by this gene is a cell surface antigen that is expressed in greater than 95% of human colon cancers. The open reading frame encodes a 319-amino acid polypeptide having a putative secretory signal sequence and 3 potential glycosylation sites. The predicted mature protein has a 213-amino acid extracellular region, a single transmembrane domain, and a 62-amino acid intracellular tail. The sequence of the extracellular region contains 2 domains characteristic of the CD2 subgroup of the immunoglobulin (Ig) superfamily.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for A33/GPA33 Antibody (NBP1-89332)(1)

Publication using NBP1-89332

• Wu CC, Hsu CW, Chen CD et al. Candidate Serological Biomarkers for Cancer Identified from the Secretomes of 23 Cancer Cell Lines and the Human Protein Atlas. Mol Cell Proteomics 2010-06-01 [PMID: 20124221]

Bioinformatics

• Gene Symbol: GPA33