FAM84A Antibody

Images

 
Western Blot: FAM84A Antibody [NBP2-14006] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: FAM84A Antibody [NBP2-14006] - Immunofluorescent staining of human cell line RT4 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: FAM84A Antibody [NBP2-14006] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAM84A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PSGIEKDELRVGVAYFFSDDEEDLDERGQPDKFGVKAPPGCTPCPESPSR HHHHLLHQLVLNETQFSAFRGQECIFSKVSGGP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FAM84A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FAM84A Protein (NBP2-14006PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FAM84A Antibody

  • family with sequence similarity 84, member A
  • FLJ35392
  • Neurologic sensory protein 1
  • neurological/sensory 1
  • NSE1PP11517

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-469
Species: Hu, Mu
Applications: WB, ICC/IF, IP
H00079677-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
H00056852-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-79687
Species: Hu
Applications: WB
NB110-58870
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF
NBP2-42643
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-03263
Species: Hu
Applications: WB, Flow, IHC, IHC-P
PP-N4111-00
Species: Hu
Applications: WB, IHC, IP
NBP2-25166
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF
NB200-109
Species: Hu, Mu
Applications: WB, ChIP, Flow, GS, ICC/IF, IP, CyTOF-ready
NBP2-45224
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-92164
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-47871
Species: Hu, Mk, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB110-57150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-32455
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP2-14006
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for FAM84A Antibody (NBP2-14006) (0)

There are no publications for FAM84A Antibody (NBP2-14006).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM84A Antibody (NBP2-14006) (0)

There are no reviews for FAM84A Antibody (NBP2-14006). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FAM84A Antibody (NBP2-14006) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FAM84A Products

Bioinformatics Tool for FAM84A Antibody (NBP2-14006)

Discover related pathways, diseases and genes to FAM84A Antibody (NBP2-14006). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FAM84A Antibody (NBP2-14006)

Discover more about diseases related to FAM84A Antibody (NBP2-14006).
 

Pathways for FAM84A Antibody (NBP2-14006)

View related products by pathway.

PTMs for FAM84A Antibody (NBP2-14006)

Learn more about PTMs related to FAM84A Antibody (NBP2-14006).

Blogs on FAM84A

There are no specific blogs for FAM84A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM84A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FAM84A