FAM180A Antibody


Immunohistochemistry-Paraffin: FAM180A Antibody [NBP1-81638] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

FAM180A Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: MCHRWSRAVLFPAAHRPKRSSSLPLNPVLQTSLEEVELLYEFLLAELEISPDLQISIKDEELASLRKASDFRTVCNN
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FAM180A Protein (NBP1-81638PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (83%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for FAM180A Antibody

  • family with sequence similarity 180, member A
  • HWKM1940
  • hypothetical protein LOC389558
  • UNQ1940


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, PEP-ELISA
Species: Mu
Applications: WB, IHC
Species: Hu, Mu, Rt, Ch, Rb
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Mu
Applications: WB
Species: Mu
Applications: WB
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, IHC, ICC
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Species: Hu
Applications: WB, ICC
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, PEP-ELISA

Publications for FAM180A Antibody (NBP1-81638) (0)

There are no publications for FAM180A Antibody (NBP1-81638).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM180A Antibody (NBP1-81638) (0)

There are no reviews for FAM180A Antibody (NBP1-81638). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FAM180A Antibody (NBP1-81638) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional FAM180A Products

Bioinformatics Tool for FAM180A Antibody (NBP1-81638)

Discover related pathways, diseases and genes to FAM180A Antibody (NBP1-81638). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FAM180A Antibody (NBP1-81638)

Discover more about diseases related to FAM180A Antibody (NBP1-81638).

Pathways for FAM180A Antibody (NBP1-81638)

View related products by pathway.

Blogs on FAM180A

There are no specific blogs for FAM180A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FAM180A Antibody and receive a gift card or discount.


Gene Symbol FAM180A