Recombinant Human FIBIN Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human FIBIN Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 211 of Human FIBIN full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MVFLKFFCMSFFCHLCQGYFDGPLYPEMSNGTLHHYFVPDGDYEENDDPEKCQLLFRVSDHRRCSQGEGSQVGSLLSLTLREEFTVLGRQVEDAGRVLEGISKSISYDLDGEESYGKYLRRESHQIGDAYSNSDKSLTELESKFKQGQEQDSRQESRLNEDFLGMLVHTRSLLKETLDISVGLRDKYELLALTIRSHGTRLGRLKNDYLKV

Protein/Peptide Type
Recombinant Protein
Gene
FIBIN

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FIBIN Protein

  • fin bud initiation factor homolog (zebrafish)
  • fin bud initiation factor homolog
  • MGC24932

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF-252-PB
Species: Hu
Applications: WB
AF482
Species: Mu
Applications: WB, IHC
NBP1-88447
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-64779
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P, IP
NBP1-31365
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, IHC, IHC-P
H00064399-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
3900-WN/CF
Species: Mu
NBP1-81638
Species: Hu
Applications: IHC, IHC-P
AF4817
Species: Mu
Applications: WB
NB600-488
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF4309
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP1-60099
Species: Hu
Applications: WB, ICC/IF, IHC
NBP1-83237
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF3646
Species: Hu
Applications: WB, ICC
NBP1-84037
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00387758-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for FIBIN Recombinant Protein (H00387758-P01) (0)

There are no publications for FIBIN Recombinant Protein (H00387758-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FIBIN Recombinant Protein (H00387758-P01) (0)

There are no reviews for FIBIN Recombinant Protein (H00387758-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FIBIN Recombinant Protein (H00387758-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FIBIN Products

Bioinformatics Tool for FIBIN Recombinant Protein (H00387758-P01)

Discover related pathways, diseases and genes to FIBIN Recombinant Protein (H00387758-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FIBIN Recombinant Protein (H00387758-P01)

Discover more about diseases related to FIBIN Recombinant Protein (H00387758-P01).
 

Pathways for FIBIN Recombinant Protein (H00387758-P01)

View related products by pathway.

PTMs for FIBIN Recombinant Protein (H00387758-P01)

Learn more about PTMs related to FIBIN Recombinant Protein (H00387758-P01).

Blogs on FIBIN

There are no specific blogs for FIBIN, but you can read our latest blog posts.

Customers Who Bought This Also Bought

FIBIN Antibody
NBP1-81154

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FIBIN Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FIBIN