FAM12B Antibody

Images

 
Immunohistochemistry-Paraffin: FAM12B Antibody [NBP1-87937] - Staining of human epididymis shows moderate membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAM12B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EVSWREFMKQHYLSPSREFREYKCDVLMRENEALKDKSSHMFIYISWYKIEHICTSDNWMDRFRNAYVWVQNPLKVLKCHQENSKNSYTESRSFNYIEFHCSMDGYVDSIEDLKMVEPIGN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EDDM3B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FAM12B Protein (NBP1-87937PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FAM12B Antibody

  • epididymal protein 3B
  • epididymal secretory protein E3 beta
  • epididymal secretory protein E3-beta
  • FAM12B
  • HE3B
  • HE3-BETA
  • human epididymis-specific 3 beta
  • human epididymis-specific protein 3-beta
  • member B (epididymal)
  • UNQ6412/PRO21187

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13945
Species: Hu
Applications: IHC, IHC-P
NBP1-84833
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-84835
Species: Hu
Applications: WB, IHC, IHC-P
MAB6656
Species: Hu
Applications: WB, IHC
NBP2-02615
Species: Hu, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-236
Species: Hu, Mu
Applications: WB, IB, IHC, IHC-Fr, IHC-P, IP
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-02164
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF1396
Species: Hu
Applications: WB
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
MAB35661
Species: Hu
Applications: WB, IHC, IP, Neut
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
NBP1-54755
Species: Hu
Applications: WB
NBP2-30636
Species: Hu
Applications: WB, IHC, IHC-P

Publications for FAM12B Antibody (NBP1-87937) (0)

There are no publications for FAM12B Antibody (NBP1-87937).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM12B Antibody (NBP1-87937) (0)

There are no reviews for FAM12B Antibody (NBP1-87937). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FAM12B Antibody (NBP1-87937) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FAM12B Products

Bioinformatics Tool for FAM12B Antibody (NBP1-87937)

Discover related pathways, diseases and genes to FAM12B Antibody (NBP1-87937). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on FAM12B

There are no specific blogs for FAM12B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM12B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EDDM3B