FAM12B Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: EVSWREFMKQHYLSPSREFREYKCDVLMRENEALKDKSSHMFIYISWYKIEHICTSDNWMDRFRNAYVWVQNPLKVLKCHQENSKNSYTESRSFNYIEFHCSMDGYVDSIEDLKMVEPIGN |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
EDDM3B |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:1000 - 1:2500
- Immunohistochemistry-Paraffin 1:1000 - 1:2500
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for FAM12B Antibody
Background
Testicular sperm are morphologically differentiated but are not progressively motile nor able to fertilize an egg.Post-testicular maturation requires exposure of spermatozoa to the microenvironment of the epididymal lumen.Spermatozoa undergo extensive changes in the epididymis, including enzymatic modifications, loss of pre-existingcomponents and addition of new glycoproteins from epididymal secretions. These modifying proteins and enzymes aresynthesized by epithelial cells lining the epididymal duct and secreted apically into the lumen, where they come intocontact with, and may be absorbed onto, the sperm membranes. The proteins encoded by the genes in this cluster aresynthesized and secreted by epididymal epithelial cells. (provided by RefSeq)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Bv, Hu, Pm, Pm
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Am, Av, Fi, Ma, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
Species: Bt, Hu, Pm, Pm
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Pm, Pm
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IB, IHC, IHC-Fr, IP, WB
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: EnzAct
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
Publications for FAM12B Antibody (NBP1-87937) (0)
There are no publications for FAM12B Antibody (NBP1-87937).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for FAM12B Antibody (NBP1-87937) (0)
There are no reviews for FAM12B Antibody (NBP1-87937).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for FAM12B Antibody (NBP1-87937) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional FAM12B Products
Bioinformatics Tool for FAM12B Antibody (NBP1-87937)
Discover related pathways, diseases and genes to FAM12B Antibody (NBP1-87937). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Blogs on FAM12B