Recombinant Human FAM12A GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human FAM12A Protein [H00010876-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human FAM12A GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-147 of Human FAM12A full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MTSSLKIWGILLALLCILCRLCVYSNNIYWREFIKLHYLSPSREFKEYKCDVLMREKEALKGKSFHMFIYSLWFKIQRACINEKGSDRYRNAYVWAPGALKVLECHWEKYNNRYTESRSFSYIEFHCGVDGYVDNIEDLRIIEPISN

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
EDDM3A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
44 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FAM12A GST (N-Term) Protein

  • EP3A
  • epididymal protein 3A
  • epididymal secretory protein E3-alpha
  • epididymis-specific 3 alpha
  • FAM12AMGC119615
  • family with sequence similarity 12, member A
  • HE3Aepididymal secretory protein E3 alpha
  • HE3ALPHA
  • HE3-ALPHA
  • human epididymis-specific 3 alpha
  • Human epididymis-specific protein 3-alpha
  • MGC119614

Background

Testicular sperm are morphologically differentiated but are not progressively motile nor able to fertilize an egg. Post-testicular maturation requires exposure of spermatozoa to the microenvironment of the epididymal lumen. Spermatozoa undergo extensive changes in the epididymis, including enzymatic modifications, loss of pre-existing components and addition of new glycoproteins from epididymal secretions. These modifying proteins and enzymes are synthesized by epithelial cells lining the epididymal duct and secreted apically into the lumen, where they come into contact with, and may be absorbed onto, the sperm membranes. The proteins encoded by the genes in this cluster are synthesized and secreted by epididymal epithelial cells. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NLS3890
Species: Bv, Hu, Pm, Pm
Applications: IHC, IHC-P
NBP3-16740
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NLS975
Species: Bt, Hu, Pm, Pm
Applications: IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MEP00B
Species: Mu
Applications: ELISA
NBP2-92856
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-87937
Species: Hu
Applications: IHC, IHC-P
NB100-56508
Species: Av, Hu, Mu, Rt
Applications: CyTOF-ready, Flow-CS, Flow, IHC, IHC-P, WB
462-TR/CF
Species: Mu
Applications: BA
NBP1-58268
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-38770
Species: Hu, Mu
Applications: IHC-P, WB
NBP2-59438
Species: Hu
Applications: ELISA, ICC/IF, WB
NB300-213
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, KD, WB
NBP2-54301
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, IHC, IHC-P, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
6057-NG/CF
Species: Hu
Applications: BA

Publications for FAM12A Recombinant Protein (H00010876-P01) (0)

There are no publications for FAM12A Recombinant Protein (H00010876-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM12A Recombinant Protein (H00010876-P01) (0)

There are no reviews for FAM12A Recombinant Protein (H00010876-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FAM12A Recombinant Protein (H00010876-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FAM12A Products

Array H00010876-P01

Bioinformatics Tool for FAM12A Recombinant Protein (H00010876-P01)

Discover related pathways, diseases and genes to FAM12A Recombinant Protein (H00010876-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on FAM12A

There are no specific blogs for FAM12A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FAM12A GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol EDDM3A