FALDH Antibody

Images

 
Western Blot: FALDH Antibody [NBP1-59679] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.
Immunohistochemistry: FALDH Antibody [NBP1-59679] - Human Adult Adrenal Observed Staining: Cytoplasm in hepatocytes Primary Antibody Concentration: 1 : 600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody ...read more
Western Blot: FALDH Antibody [NBP1-59679] - NCI-H226 cell lysate, concentration 0.2-1 ug/ml.
Western Blot: FALDH Antibody [NBP1-59679] - Positive control: Lane1 : 30ug human Primary hepatocytes Primary, Antibody Dilution: 1 : 1000 Secondary Antibody: Anti-rabbit-HRP Secondry, Antibody Dilution: 1 : 5000.
Western Blot: FALDH Antibody [NBP1-59679] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FALDH Antibody Summary

Immunogen
Synthetic peptides corresponding to ALDH3A2(aldehyde dehydrogenase 3 family, member A2) The peptide sequence was selected from the middle region of ALDH3A2 (NP_001026976). Peptide sequence DHIFYTGNTAVGKIVMEAAAKHLTPVTLELGGKSPCYIDKDCDLDIVCRR.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ALDH3A2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
  • Immunohistochemistry
Theoretical MW
58 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for FALDH Antibody

  • Aldehyde dehydrogenase 10
  • aldehyde dehydrogenase 3 family, member A2
  • Aldehyde dehydrogenase family 3 member A2
  • ALDH10FLJ20851
  • EC 1.2.1
  • EC 1.2.1.3
  • FALDHDKFZp686E23276
  • fatty aldehyde dehydrogenase
  • Microsomal aldehyde dehydrogenase
  • SLS

Background

Aldehyde dehydrogenase isozymes are thought to play a major role in the detoxification of aldehydes generated by alcohol metabolism and lipid peroxidation. ALDH3A2 catalyzes the oxidation of long-chain aliphatic aldehydes to fatty acid.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB7265
Species: Mu
Applications: WB, IHC
NBP2-02483
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-25196
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, In vitro, CyTOF-ready
NBP2-15304
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-02164
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-32899
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-06542
Species: Hu
Applications: WB, IHC, IHC-P, IP
44260002
Species: Hu
Applications: WB, ELISA
AF743
Species: Mu
Applications: WB, Flow, CyTOF-ready
NBP1-89076
Species: Hu
Applications: IHC, IHC-P
NBP2-25208
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP

Publications for FALDH Antibody (NBP1-59679) (0)

There are no publications for FALDH Antibody (NBP1-59679).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FALDH Antibody (NBP1-59679) (0)

There are no reviews for FALDH Antibody (NBP1-59679). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FALDH Antibody (NBP1-59679) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FALDH Products

Bioinformatics Tool for FALDH Antibody (NBP1-59679)

Discover related pathways, diseases and genes to FALDH Antibody (NBP1-59679). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FALDH Antibody (NBP1-59679)

Discover more about diseases related to FALDH Antibody (NBP1-59679).
 

Pathways for FALDH Antibody (NBP1-59679)

View related products by pathway.

PTMs for FALDH Antibody (NBP1-59679)

Learn more about PTMs related to FALDH Antibody (NBP1-59679).
 

Research Areas for FALDH Antibody (NBP1-59679)

Find related products by research area.

Blogs on FALDH

There are no specific blogs for FALDH, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FALDH Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ALDH3A2
Entrez
Uniprot