FAIM3 Antibody (1E4)

Images

 
Western Blot: FAIM3 Antibody (1E4) [H00009214-M01] - FAIM3 monoclonal antibody (M01), clone 1E4 Analysis of FAIM3 expression in K-562.
Western Blot: FAIM3 Antibody (1E4) [H00009214-M01] - Analysis of FAIM3 expression in transfected 293T cell line by FAIM3 monoclonal antibody (M01), clone 1E4.Lane 1: FAIM3 transfected lysate(43.1 KDa).Lane 2: ...read more
ELISA: FAIM3 Antibody (1E4) [H00009214-M01] - ELISA analysis of FAIM3 in PBMC CD14 negative fraction. Image courtesy of anonymous customer product review.
ELISA: FAIM3 Antibody (1E4) [H00009214-M01] - Detection limit for recombinant GST tagged FAIM3 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, Flow
Clone
1E4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

FAIM3 Antibody (1E4) Summary

Immunogen
FAIM3 (AAH06401, 124 a.a. ~ 223 a.a) partial recombinant protein with GST tag.SEYEPSWEEQPMPETPKWFHLPYLFQMPAYASSSKFVTRVTT PAQRGKVPPVHHSSPTTQITHRPRVSRASSVAGDKPRTFLPS TTASKISALEGLLKPQ
Specificity
FAIM3 - Fas apoptotic inhibitory molecule 3
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
FAIM3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA 1:100-1:2000
  • Flow Cytometry
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. Use in FLOW cytometry reported in scientific literature ( PMID 25769920)
Reviewed Applications
Read 1 Review rated 3
using
H00009214-M01 in the following applications:

Publications
Read Publications using
H00009214-M01 in the following applications:

Reactivity Notes

Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FAIM3 Antibody (1E4)

  • FAIM3
  • Fas apoptotic inhibitory molecule 3
  • Fc mu R
  • Fc mu receptor
  • FCMR
  • immunoglobulin mu Fc receptor
  • Regulator of Fas-induced apoptosis Toso
  • Toso
  • TOSOIgM Fc receptor

Background

Apoptosis is an important process in maintaining normal tissue homeostasis and function. One of the major signals that regulate this process is mediated by the activation of the Fas receptor by its ligand. This leads to the formation of a Fas associated death domain (FADD), containing death inducing signalling complex, and the activation of caspase-8, which in turn activates downstream effector caspases, such as caspase-3 and -7 (Curting and Cotter, 2003). Recent experiments have shown that overexpression of FAIM3, a novel regulator of Fas induced apoptosis in lymphoid cells, Jurkat cells and in transgenic mice renders these cells resistant to Fas induced apoptosis but not to TRAIL induced apoptosis (Hitoshi et al, 1998; Song and Jacob, 2005). Furthermore, FAIM3 was found to associate with FADD, suggesting that it functions by disrupting the formation of the death inducing signalling complex. Despite its predicted molecular weight, FAIM3 often migrates at 60 kDa in SDS PAGE.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF144
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-25250
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
MAB6302
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NB110-60490
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-25196
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, In vitro, CyTOF-ready
NBP1-81831
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00003669-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
MAB1642
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-77020
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for FAIM3 Antibody (H00009214-M01)(4)

Review for FAIM3 Antibody (H00009214-M01) (1) 31

Average Rating: 3
(Based on 1 review)
We have 1 review tested in 1 species: Human.
We have 1 review tested in 1 application: ELISA.

Reviews using H00009214-M01:
Filter by Applications
ELISA
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
ELISA FAIM3 H00009214-M01
Enlarge
reviewed by:
Florence Anquetil
ELISA Human 02/08/2012
View

Summary

ApplicationELISA
Sample TestedPBMC CD14 negative fraction (Tcells, Bcells and NK cells)
SpeciesHuman
Comments"dilution used : 1/100 in PBS 1% BSA (30min on ice)1 wash Secondary antibody : goat anti mouse total IgG -FITC (Invitrogen) : 1/100 in PBS 1% BSA (30min on ice)2 washesData : FACSCAN, Beckman Coulter"

Primary Anitbody

Dilution RatioIncubation Dilution Buffer: PBS BSA 1%, Dilution Ratio: 1/100, Incubation Time: 30 minutes, Incubation Temp: 4 degrees Celsius

Secondary Antibody

Secondary DescriptionSecondary Ab: goat anti human mouse total IgG -FITC, Secondary Ab Dilution: 1/100
Secondary Manufacturer Cat#Invitrogen

Details

Detection NotesNegative Control: isotype control, Wavelength: 488
ELISA Plate DetailsELISA Detection Method: Facscan, ELISA Sample Concentration: 100000 cells

Comments

Comments"dilution used : 1/100 in PBS 1% BSA (30min on ice)1 wash Secondary antibody : goat anti mouse total IgG -FITC (Invitrogen) : 1/100 in PBS 1% BSA (30min on ice)2 washesData : FACSCAN, Beckman Coulter"

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FAIM3 Antibody (H00009214-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FAIM3 Products

Bioinformatics Tool for FAIM3 Antibody (H00009214-M01)

Discover related pathways, diseases and genes to FAIM3 Antibody (H00009214-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FAIM3 Antibody (H00009214-M01)

Discover more about diseases related to FAIM3 Antibody (H00009214-M01).
 

Pathways for FAIM3 Antibody (H00009214-M01)

View related products by pathway.

PTMs for FAIM3 Antibody (H00009214-M01)

Learn more about PTMs related to FAIM3 Antibody (H00009214-M01).
 

Research Areas for FAIM3 Antibody (H00009214-M01)

Find related products by research area.

Blogs on FAIM3

There are no specific blogs for FAIM3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

3
5
0
4
0
3
1
2
0
1
0

Florence Anquetil
02/08/2012
Application: ELISA
Species: Human

Bioinformatics

Gene Symbol FAIM3
Entrez
OMIM
Uniprot