FAIM3 Antibody (1E4) - Azide and BSA Free

Western Blot: FAIM3 Antibody (1E4) [H00009214-M01] - FAIM3 monoclonal antibody (M01), clone 1E4 Analysis of FAIM3 expression in K-562.

Western Blot: FAIM3 Antibody (1E4) [H00009214-M01] - Analysis of FAIM3 expression in transfected 293T cell line by FAIM3 monoclonal antibody (M01), clone 1E4.Lane 1: FAIM3 transfected lysate(43.1 KDa).Lane 2: Non-transfected lysate.

ELISA: FAIM3 Antibody (1E4) [H00009214-M01] - ELISA analysis of FAIM3 in PBMC CD14 negative fraction. Image courtesy of anonymous customer product review.

ELISA: FAIM3 Antibody (1E4) [H00009214-M01] - Detection limit for recombinant GST tagged FAIM3 is approximately 0.03ng/ml as a capture antibody.

• Reactivity: Hu, Mu
• Applications: WB, ELISA, Flow, IHC
• Clone: 1E4
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

FAIM3 Antibody (1E4) - Azide and BSA Free Summary

• Immunogen: FAIM3 (AAH06401, 124 a.a. ~ 223 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SEYEPSWEEQPMPETPKWFHLPYLFQMPAYASSSKFVTRVTTPAQRGKVPPVHHSSPTTQITHRPRVSRASSVAGDKPRTFLPSTTASKISALEGLLKPQ
• Specificity: FAIM3 - Fas apoptotic inhibitory molecule 3
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: FCMR
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA 1:100-1:2000
  • Flow Cytometry
  • Immunohistochemistry
  • Western Blot 1:500
• Application Notes: Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. Use in FLOW cytometry reported in scientific literature ( PMID 25769920)

Reactivity Notes

Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FAIM3 Antibody (1E4) - Azide and BSA Free

• FAIM3
• Fas apoptotic inhibitory molecule 3
• Fc mu R
• Fc mu receptor
• FCMR
• immunoglobulin mu Fc receptor
• Regulator of Fas-induced apoptosis Toso
• Toso
• TOSOIgM Fc receptor

Background

Apoptosis is an important process in maintaining normal tissue homeostasis and function. One of the major signals that regulate this process is mediated by the activation of the Fas receptor by its ligand. This leads to the formation of a Fas associated death domain (FADD), containing death inducing signalling complex, and the activation of caspase-8, which in turn activates downstream effector caspases, such as caspase-3 and -7 (Curting and Cotter, 2003). Recent experiments have shown that overexpression of FAIM3, a novel regulator of Fas induced apoptosis in lymphoid cells, Jurkat cells and in transgenic mice renders these cells resistant to Fas induced apoptosis but not to TRAIL induced apoptosis (Hitoshi et al, 1998; Song and Jacob, 2005). Furthermore, FAIM3 was found to associate with FADD, suggesting that it functions by disrupting the formation of the death inducing signalling complex. Despite its predicted molecular weight, FAIM3 often migrates at 60 kDa in SDS PAGE.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FAIM3 Antibody (H00009214-M01)(6)

Publications using H00009214-M01

• Andrews JM, Pyfrom SC, Schmidt JA Et al. Loss of synergistic transcriptional feedback loops drives diverse B-cell cancers EBioMedicine 2021-08-27 [PMID: 34461601] (FLOW)
• Lloyd KA, Wang J, Urban BC et al. Glycan-independent binding and internalization of human IgM to FCMR, its cognate cellular receptor. Sci Rep 2017-02-23 [PMID: 28230186]
• Anquetil F, Clavel C, Offer G et al. IgM and IgA Rheumatoid Factors Purified from Rheumatoid Arthritis Sera Boost the Fc Receptor- and Complement-Dependent Effector Functions of the Disease-Specific Anti-Citrullinated Protein Autoantibodies. J. Immunol. 2015-03-13 [PMID: 25769920] (FLOW, Human)
• Murakami Y, Narayanan S, Su S et al. Toso, a Functional IgM Receptor, Is Regulated by IL-2 in T and NK Cells. J Immunol. 2012-06-06 [PMID: 22675200]
• Li FJ, Kubagawa Y, McCollum MK et al. Enhanced levels of both membrane-bound and soluble forms of IgM Fc receptor in patients with chronic lymphocytic leukemia. Blood. 2011-09-09 [PMID: 21908424]
• Proto-Siqueira R, Panepucci RA, Careta FP et al. SAGE analysis demonstrates increased expression of TOSO contributing to Fas mediated resistance in CLL. Blood;112(2):394-7. 2008-07-15 [PMID: 18434611]

Review for FAIM3 Antibody (H00009214-M01) (1)

Average Rating: 3

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Florence Anquetil ELISA Human 02/08/2012

Summary

• Application: ELISA
• Sample Tested: PBMC CD14 negative fraction (Tcells, Bcells and NK cells)
• Species: Human

Bioinformatics

• Gene Symbol: FCMR
• Entrez:
  • 9214(Human)
• OMIM:
  • 606015(Human)
• Uniprot:
  • AAH06401(Human)