FABP7/B-FABP Antibody

Images

 
Western Blot: FABP7/B-FABP Antibody [NBP1-88648] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: FABP7/B-FABP Antibody [NBP1-88648] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: FABP7/B-FABP Antibody [NBP1-88648] - Staining of human hippocampus shows strong cytoplasmic and nuclear positivity in subsets of glial cells.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FABP7/B-FABP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCK
Marker
Neuronal Marker
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FABP7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FABP7/B-FABP Protein (NBP1-88648PEP)
Publications
Read Publications using
NBP1-88648 in the following applications:

  • IHC
    2 publications

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%). Reactivity reported in scientific literature (PMID: 24653654)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FABP7/B-FABP Antibody

  • BFABP
  • B-FABP
  • B-FABPDKFZp547J2313
  • BLBP
  • BLBPMRG
  • Brain lipid-binding protein
  • Brain-type fatty acid-binding protein
  • FABP7
  • FABPBbrain lipid binding protein
  • fatty acid binding protein 7, brain
  • Fatty acid-binding protein 7
  • fatty acid-binding protein, brain
  • Mammary-derived growth inhibitor related
  • mammary-derived growth inhibitor-related

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1476
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-16708
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87695
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1678
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
AF1443
Species: Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NB100-59746
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-2564
Species: Hu
Applications: WB
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-89064
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB400-144
Species: Hu, Mu, Rt, Po, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
MAB1259
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow

Publications for FABP7/B-FABP Antibody (NBP1-88648)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(2)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for FABP7/B-FABP Antibody (NBP1-88648) (0)

There are no reviews for FABP7/B-FABP Antibody (NBP1-88648). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FABP7/B-FABP Antibody (NBP1-88648) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FABP7/B-FABP Products

Bioinformatics Tool for FABP7/B-FABP Antibody (NBP1-88648)

Discover related pathways, diseases and genes to FABP7/B-FABP Antibody (NBP1-88648). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FABP7/B-FABP Antibody (NBP1-88648)

Discover more about diseases related to FABP7/B-FABP Antibody (NBP1-88648).
 

Pathways for FABP7/B-FABP Antibody (NBP1-88648)

View related products by pathway.

PTMs for FABP7/B-FABP Antibody (NBP1-88648)

Learn more about PTMs related to FABP7/B-FABP Antibody (NBP1-88648).
 

Research Areas for FABP7/B-FABP Antibody (NBP1-88648)

Find related products by research area.

Blogs on FABP7/B-FABP

There are no specific blogs for FABP7/B-FABP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FABP7/B-FABP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FABP7
Entrez