ADHFE1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ADHFE1 Antibody [NBP1-83530] - Immunofluorescent staining of human cell line A-431 shows localization to vesicles.

Immunohistochemistry-Paraffin: ADHFE1 Antibody [NBP1-83530] - Staining in human liver and pancreas tissues using anti-ADHFE1 antibody. Corresponding ADHFE1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: ADHFE1 Antibody [NBP1-83530] - Staining of human liver shows high expression.

Immunohistochemistry-Paraffin: ADHFE1 Antibody [NBP1-83530] - Staining of human pancreas shows low expression as expected.

Analysis in human cell line HDLM-2.

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ADHFE1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ADHFE1 Antibody - BSA Free (NBP1-83530) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LEMAEILGADTRTARIQDAGLVLADTLRKFLFDLDVDDGLAAVGYSKADIPALVKGTLPQERVTKLAPCPQSEEDLAALFEASMKL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ADHFE1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ADHFE1 Protein (NBP1-83530PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ADHFE1 Antibody - BSA Free

• ADH8
• alcohol dehydrogenase, iron containing, 1
• EC 1.1.99.24
• Fe-containing alcohol dehydrogenase
• HOTmitochondrial
• MGC48605

Background

ADHFE1, also known as hydroxyacid-oxoacid transhydrogenase, contains a 50 kDa, 45 kDa, 33 kDa, and 27 kDa isoform, and is involved in oxidation in mammalian tissues. Current research on ADHFE1 includes its relation to a variety of disorders and diseases, including alcohol-related neurodevelopmental disorder, pneumonia, patellar tendinitis, hepatoblastoma, cholangiocarcinoma, Pontiac fever, alcoholism, Legionnaires' disease, and intrahepatic cholangiocarcinoma. This protein is linked to pyruvate metabolism, the citric acid (TCA) cycle, and respiratory electron transport, where it interacts with GNAQ and LIPC.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ADHFE1
• Entrez:
  • 137872(Human)
• Uniprot:
  • Q8IWW8(Human)