EYA1 Antibody - Azide and BSA Free

Western Blot: EYA1 Antibody [NBP3-04365] - Western blot analysis of extracts of various cell lines, using EYA1 Rabbit pAb (NBP3-04365) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.

Immunohistochemistry-Paraffin: EYA1 Antibody [NBP3-04365] - Immunohistochemistry of paraffin-embedded Rat brain using EYA1 Rabbit pAb (NBP3-04365) at dilution of 1:100 (40x lens).

Immunohistochemistry-Paraffin: EYA1 Antibody [NBP3-04365] - Immunohistochemistry of paraffin-embedded Human placenta using EYA1 Rabbit pAb (NBP3-04365) at dilution of 1:100 (40x lens).

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

EYA1 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit EYA1 Antibody - Azide and BSA Free (NBP3-04365) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human EYA1 (NP_000494.2). NSLTNSSGFNSSQQDYPSYPSFGQGQYAQYYNSSPYPAHYMTSSNTSPTTPSTNATYQLQEPPSGITSQAVTDPTAEYSTIHSPSTPIKDSDSDRLRRGSD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EYA1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:200-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for EYA1 Antibody - Azide and BSA Free

• BOP
• BOR
• EC 3.1.3.48
• eyes absent (Drosophila) homolog 1
• eyes absent homolog 1 (Drosophila)
• eyes absent homolog 1
• MGC141875

Background

The EYA1 gene encodes an eyes absent homolog 1 protein that exists in three isoforms: isoform 1: 592 amino acids long, 64 kDA; isoform 2: 559 amino acids long, 61 kDA; and isoform 3: 557 amino acids long; 60 kDA. The protein coded by the EYA1 gene functions in the development of the kidney, brancial arches, eyes, and ears. Mutations in the EYA1 gene lead to branchiootorenal dysplasia syndrome, congenital cataracts and ocular anterior segment anomalies, and branchiootic syndrome. The EYA1 gene is also linked to fraser syndrome, microphthalmia, cataracts, enlarged vestibular aqueducts, townes-brocks syndrome, and anophthalmia.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: EYA1