EYA1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: EYA1 Antibody [NBP2-58069] - Staining of human cell line RH-30 shows localization to nucleoplasm & nuclear bodies. Antibody staining is shown in green.
Immunohistochemistry-Frozen: EYA1 Antibody [NBP2-58069] - The staining was done on an E11.5 mouse transverse section (fixed on 4% PFA overnight) and done using standard IF techniques. Antibody at 1:50. Blocking: 1 hour ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC-Fr
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EYA1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SQSPGQTGFLSYGTSFSTPQPGQAPYSYQMQGSSFTTSSGIYTGNNSLTNSSGFNSSQQDYPSYPSFGQGQYAQYYNSSPYPAHYMTSSNTSPTTPSTNATYQLQEPPSGITSQAVTDPTAEYSTIHSPSTPIKDSDSDRLRRGSD
Predicted Species
Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EYA1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25 - 2 ug/mL
  • Immunohistochemistry-Frozen
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. This EYA1 Antibody is validated for IHC-Fr from a verified customer review.
Control Peptide
EYA1 Recombinant Protein Antigen (NBP2-58069PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP2-58069 in the following applications:

Reactivity Notes

Mouse reactivity reported from a verified customer review.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for EYA1 Antibody

  • BOP
  • BOR
  • EC 3.1.3.48
  • eyes absent (Drosophila) homolog 1
  • eyes absent homolog 1 (Drosophila)
  • eyes absent homolog 1
  • MGC141875

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-75618
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-86665
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31593
Species: Hu
Applications: WB
NBP3-10377
Species: Hu
Applications: WB
NBP1-84264
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, KD
H00002770-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NBP2-94031
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006936-B01P
Species: Hu
Applications: WB, ICC/IF
H00005076-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB300-731
Species: Hu, Mu, Rt, Gp, Rb, Sh, Ye
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, B/N
NBP3-04883
Species: Hu, Mu, Rt
Applications: WB
NBP2-67150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58069
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC-Fr

Publications for EYA1 Antibody (NBP2-58069) (0)

There are no publications for EYA1 Antibody (NBP2-58069).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for EYA1 Antibody (NBP2-58069) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP2-58069:
Filter by Applications
IHC-Fr
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Frozen EYA1 NBP2-58069
Enlarge
5
reviewed by:
Anonymous
IHC-Fr Mouse 02/12/2021
View

Summary

ApplicationImmunohistochemistry-Frozen
Sample TestedE11.5 mouse embryo fixed in 4% PFA
SpeciesMouse
LotR30889

Comments

CommentsDilution used - 1:50. The staining was done on an E11.5 mouse transverse section (fixed on 4% PFA overnight) and done using standard IF techniques.
Blocking - 1 hour with 1% BSA before addition of the primary antibody
Secondary antibody - Alexa Fluor Donkey Anti Rabbit 488
***Novus Innovators Program - new species or application used on a primary antibody.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for EYA1 Antibody (NBP2-58069) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional EYA1 Products

Bioinformatics Tool for EYA1 Antibody (NBP2-58069)

Discover related pathways, diseases and genes to EYA1 Antibody (NBP2-58069). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EYA1 Antibody (NBP2-58069)

Discover more about diseases related to EYA1 Antibody (NBP2-58069).
 

Pathways for EYA1 Antibody (NBP2-58069)

View related products by pathway.

PTMs for EYA1 Antibody (NBP2-58069)

Learn more about PTMs related to EYA1 Antibody (NBP2-58069).
 

Research Areas for EYA1 Antibody (NBP2-58069)

Find related products by research area.

Blogs on EYA1

There are no specific blogs for EYA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Anonymous
02/12/2021
Application: IHC-Fr
Species: Mouse

Bioinformatics

Gene Symbol EYA1