EYA1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: EYA1 Antibody [NBP2-58069] - Staining of human cell line RH-30 shows localization to nucleoplasm & nuclear bodies.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EYA1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SQSPGQTGFLSYGTSFSTPQPGQAPYSYQMQGSSFTTSSGIYTGNNSLTNSSGFNSSQQDYPSYPSFGQGQYAQYYNSSPYPAHYMTSSNTSPTTPSTNATYQLQEPPSGITSQAVTDPTAEYSTIHSPSTPIKDSDSDRLRRGSD
Specificity
Specificity of human EYA1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EYA1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
EYA1 Recombinant Protein Antigen (NBP2-58069PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for EYA1 Antibody

  • BOP
  • BOR
  • EC 3.1.3.48
  • eyes absent (Drosophila) homolog 1
  • eyes absent homolog 1 (Drosophila)
  • eyes absent homolog 1
  • MGC141875

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77242
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP1-86665
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89366
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-56060
Species: Hu
Applications: ICC/IF
NBP2-67121
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
H00030813-R02
Species: Hu
NBP1-84264
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-16558
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-57622
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-05984
Species: Hu, Mu
Applications: WB, IP
H00005076-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-24940
Species: Hu, Ye
Applications: WB
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBL1-11228
Species: Hu
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58069
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for EYA1 Antibody (NBP2-58069) (0)

There are no publications for EYA1 Antibody (NBP2-58069).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EYA1 Antibody (NBP2-58069) (0)

There are no reviews for EYA1 Antibody (NBP2-58069). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for EYA1 Antibody (NBP2-58069) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for EYA1 Antibody (NBP2-58069)

Discover related pathways, diseases and genes to EYA1 Antibody (NBP2-58069). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EYA1 Antibody (NBP2-58069)

Discover more about diseases related to EYA1 Antibody (NBP2-58069).
 

Pathways for EYA1 Antibody (NBP2-58069)

View related products by pathway.

PTMs for EYA1 Antibody (NBP2-58069)

Learn more about PTMs related to EYA1 Antibody (NBP2-58069).
 

Research Areas for EYA1 Antibody (NBP2-58069)

Find related products by research area.

Blogs on EYA1

There are no specific blogs for EYA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EYA1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EYA1