EYA1 Antibody - BSA Free

Western Blot: EYA1 Antibody [NBP1-98347] - Mouse Heart Lysate 1.0ug/ml, Gel Concentration: 12%

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

EYA1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: The immunogen for this antibody is Eya1 - middle region. Peptide sequence SGFNSSQQDYPSYPGFGQGQYAQYYNSSPYPAHYMTSSNTSPTTPSTNAT. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EYA1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 64 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for EYA1 Antibody - BSA Free

• BOP
• BOR
• EC 3.1.3.48
• eyes absent (Drosophila) homolog 1
• eyes absent homolog 1 (Drosophila)
• eyes absent homolog 1
• MGC141875

Background

The EYA1 gene encodes an eyes absent homolog 1 protein that exists in three isoforms: isoform 1: 592 amino acids long, 64 kDA; isoform 2: 559 amino acids long, 61 kDA; and isoform 3: 557 amino acids long; 60 kDA. The protein coded by the EYA1 gene functions in the development of the kidney, brancial arches, eyes, and ears. Mutations in the EYA1 gene lead to branchiootorenal dysplasia syndrome, congenital cataracts and ocular anterior segment anomalies, and branchiootic syndrome. The EYA1 gene is also linked to fraser syndrome, microphthalmia, cataracts, enlarged vestibular aqueducts, townes-brocks syndrome, and anophthalmia.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EYA1
• Uniprot:
  • NP_034294(Mouse)