ETV7 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ETV7 Antibody [NBP2-68687] - Staining of human cell line HaCaT shows localization to nucleoplasm.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ETV7 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: EGELAISPISPVAAMPPLGTHVQARCEAQINLLGEGGICKLPGRLRIQPALWSREDVLHWLRWAEQEYSLPC
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ETV7
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100
Control Peptide
ETV7 Recombinant Protein Antigen (NBP2-68687PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for ETV7 Antibody

  • ETS translocation variant 7
  • ets variant 7
  • ets variant gene 7 (TEL2 oncogene)
  • TEL2 oncogene
  • TEL-2
  • TEL2ETS-related protein Tel2
  • TELBEts transcription factor TEL-2b
  • Tel-related Ets factor
  • transcription factor ets
  • transcription factor ETV7
  • Transcription factor Tel-2
  • TREF

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80695
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-104
Species: Ca, Hu, Ma, Mu, Rt
Applications: ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, WB
NB100-308
Species: Hu, Mu
Applications: Func, ICC/IF, IP, In vitro, KO, WB
NB100-56585
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-03417
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NB600-607
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
NBP1-79034
Species: Hu
Applications: IP, WB
AF7365
Species: Hu, Mu, Rt
Applications: WB
H00023049-M02
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
NBP2-01764
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-22128
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
507-BP/CF
Species: Hu
Applications: BA
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NBP1-82756
Species: Hu
Applications: IHC, IHC-P
NBP2-20245
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
NBP2-02004
Species: Ca, Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF-242-PB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
NB110-40424
Species: Hu
Applications: IHC, IHC-P, IP, WB
NBP1-77685
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-68687
Species: Hu
Applications: ICC/IF

Publications for ETV7 Antibody (NBP2-68687) (0)

There are no publications for ETV7 Antibody (NBP2-68687).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ETV7 Antibody (NBP2-68687) (0)

There are no reviews for ETV7 Antibody (NBP2-68687). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ETV7 Antibody (NBP2-68687) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ETV7 Products

Bioinformatics Tool for ETV7 Antibody (NBP2-68687)

Discover related pathways, diseases and genes to ETV7 Antibody (NBP2-68687). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ETV7 Antibody (NBP2-68687)

Discover more about diseases related to ETV7 Antibody (NBP2-68687).
 

Pathways for ETV7 Antibody (NBP2-68687)

View related products by pathway.

PTMs for ETV7 Antibody (NBP2-68687)

Learn more about PTMs related to ETV7 Antibody (NBP2-68687).

Blogs on ETV7

There are no specific blogs for ETV7, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ETV7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ETV7