TREH Antibody

Images

 
Immunohistochemistry-Paraffin: TREH Antibody [NBP1-82756] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: TREH Antibody [NBP1-82756] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: TREH Antibody [NBP1-82756] - Staining of human small intestine shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: TREH Antibody [NBP1-82756] - Staining in human small intestine and liver tissues using anti-TREH antibody. Corresponding TREH RNA-seq data are presented for ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: TREH Antibody [NBP1-82756] - Staining of human cerebral cortex, duodenum, kidney and testis using Anti-TREH antibody NBP1-82756 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: TREH Antibody [NBP1-82756] - Staining of human testis.
Immunohistochemistry-Paraffin: TREH Antibody [NBP1-82756] - Staining of human kidney.
Immunohistochemistry-Paraffin: TREH Antibody [NBP1-82756] - Staining of human duodenum.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TREH Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LYQDDKQFVDMPLSIAPEQVLQTFTELSRDHNHSIPREQLQAFVHEHFQAKGQELQPWTPADWKDSPQFLQKISDAKLRAWAGQLHQLWKKLGKK
Specificity
Specificity of human TREH antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TREH
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TREH Antibody

  • Alpha
  • alpha-trehalase
  • alpha-trehalose glucohydrolase
  • MGC129621
  • TRE
  • TREAEC 3.2.1.28
  • trehalase (brush-border membrane glycoprotein)
  • trehalase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB110-75039
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NB100-56530
Species: Hu
Applications: WB
NBP2-67861
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57642
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-50509
Species: Hu
Applications: WB, IHC, IP
NBP1-87959
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-71770
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-86919
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-07100
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB200-585
Species: Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP2-20619
Species: Hu, Mu, Rt, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-86616
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-58917
Species: Hu
Applications: WB, IHC, IHC-P
NB300-273
Species: Mu, Rt
Applications: WB, IHC, IHC-Fr
AF1067
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
NBP1-82847
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TREH Antibody (NBP1-82756) (0)

There are no publications for TREH Antibody (NBP1-82756).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TREH Antibody (NBP1-82756) (0)

There are no reviews for TREH Antibody (NBP1-82756). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TREH Antibody (NBP1-82756) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TREH Products

Array NBP1-82756

Bioinformatics Tool for TREH Antibody (NBP1-82756)

Discover related pathways, diseases and genes to TREH Antibody (NBP1-82756). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TREH Antibody (NBP1-82756)

Discover more about diseases related to TREH Antibody (NBP1-82756).
 

Pathways for TREH Antibody (NBP1-82756)

View related products by pathway.

PTMs for TREH Antibody (NBP1-82756)

Learn more about PTMs related to TREH Antibody (NBP1-82756).
 

Research Areas for TREH Antibody (NBP1-82756)

Find related products by research area.

Blogs on TREH

There are no specific blogs for TREH, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TREH Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TREH
Novus 100% Guarantee