Novus Biologicals products are now on bio-techne.com

ETV7 Antibody

Images

 
Western Blot: ETV7 Antibody [NBP1-80694] - Analysis in human cell line HDLM-2.
Immunocytochemistry/ Immunofluorescence: ETV7 Antibody [NBP1-80694] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.
Western Blot: ETV7 Antibody [NBP1-80694] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ETV7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LLQPPDPGLTSNFGHLDDPGLARWTPGKEESLNLCHCAELGCRTQGVCSFPAMPQAPIDGRIADCRLLWDYVYQLLLDTRYEPYIK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ETV7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ETV7 Protein (NBP1-80694PEP)
Publications
Read Publications using
NBP1-80694 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ETV7 Antibody

  • ETS translocation variant 7
  • ets variant 7
  • ets variant gene 7 (TEL2 oncogene)
  • TEL2 oncogene
  • TEL-2
  • TEL2ETS-related protein Tel2
  • TELBEts transcription factor TEL-2b
  • Tel-related Ets factor
  • transcription factor ets
  • transcription factor ETV7
  • Transcription factor Tel-2
  • TREF

Background

The ETS (E26 transformation-specific) family of transcription factors, of which ETV7 is a member, is a large group of evolutionarily conserved transcriptional regulators that play an important role in a variety of cellular processes throughout development and differentiation, and are involved in oncogenesis as well (Potter et al., 2000 (PubMed 10828014)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80695
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-309
Species: Hu, Pm, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD, PAGE, Single-Cell Western, WB
NB100-308
Species: Hu, Mu
Applications: Func, ICC/IF, IP, In vitro, KO, WB
NB100-56585
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-03417
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NB600-607
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
NBP1-79034
Species: Hu
Applications: IP, WB
AF7365
Species: Hu, Mu, Rt
Applications: WB
H00023049-M02
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
NBP1-40354
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
NBP2-22128
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
507-BP
Species: Hu
Applications: BA
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NBP1-82756
Species: Hu
Applications: IHC, IHC-P
NBP2-20245
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
NBP2-02004
Species: Ca, Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF-242-PB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
NB110-40424
Species: Hu
Applications: IHC, IHC-P, IP, WB
NBP1-77685
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-80694
Species: Hu
Applications: WB, ICC/IF

Publications for ETV7 Antibody (NBP1-80694)(2)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 2 applications: IF/IHC, WB.


Filter By Application
IF/IHC
(2)
WB
(1)
All Applications
Filter By Species
Human
(1)
Mouse
(1)
All Species

Reviews for ETV7 Antibody (NBP1-80694) (0)

There are no reviews for ETV7 Antibody (NBP1-80694). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ETV7 Antibody (NBP1-80694) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ETV7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ETV7
Entrez
Uniprot