![Western Blot: ETV7 Antibody [NBP1-80694] - Analysis in human cell line HDLM-2.](http://images.novusbio.com/fullsize2/ETV7-Antibody-Western-Blot-NBP1-80694-img0007.jpg "Western Blot: ETV7 Antibody [NBP1-80694] - Analysis in human cell line HDLM-2.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LLQPPDPGLTSNFGHLDDPGLARWTPGKEESLNLCHCAELGCRTQGVCSFPAMPQAPIDGRIADCRLLWDYVYQLLLDTRYEPYIK |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ETV7 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
-Flow-Cytometry-NBP2-03417-img0001.jpg)
-Flow-Cytometry-NBP2-03417-img0002.jpg)
-Western-Blot-NBP2-03417-img0003.jpg)
-Flow-Cytometry-NB600-302-img0014.jpg)
-Flow-Cytometry-NB600-302-img0019.jpg)
-Western-Blot-NB600-302-img0022.jpg)
-Flow-Cytometry-NBP2-02004-img0001.jpg)
-Flow-Cytometry-NBP2-02004-img0002.jpg)
-Flow-Cytometry-NBP2-02004-img0003.jpg)
Secondary Antibodies |
Isotype Controls |
Diseases for ETV7 Antibody (NBP1-80694)Discover more about diseases related to ETV7 Antibody (NBP1-80694).
| Pathways for ETV7 Antibody (NBP1-80694)View related products by pathway.
|
PTMs for ETV7 Antibody (NBP1-80694)Learn more about PTMs related to ETV7 Antibody (NBP1-80694).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: ETV7 Antibody [NBP1-80694] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.](http://images.novusbio.com/fullsize2/ETV7-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-80694-img0006.jpg "Immunocytochemistry/Immunofluorescence: ETV7 Antibody [NBP1-80694] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.")
![Western Blot: ETV7 Antibody [NBP1-80694] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize2/ETV7-Antibody-Western-Blot-NBP1-80694-img0005.jpg "Western Blot: ETV7 Antibody [NBP1-80694] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
-Immunocytochemistry-Immunofluorescence-NB100-308-img0001.jpg)
-Western-Blot-NB100-308-img0004.jpg)
-Western-Blot-NB100-308-img0005.jpg)
)-Immunohistochemistry-Paraffin-NB100-56585-img0015.jpg)
)-Immunohistochemistry-Paraffin-NB100-56585-img0016.jpg)
)-Western-Blot-NB100-56585-img0017.jpg)
![Immunohistochemistry-Paraffin TOR/mTOR [p Ser2448] Antibody](https://images.novusbio.com/images2/TOR-mTOR-[p-Ser2448]-Antibody-Immunohistochemistry-Paraffin-NB600-607-img0005.jpg)
![Western Blot TOR/mTOR [p Ser2448] Antibody](https://images.novusbio.com/images2/TOR-mTOR-[p-Ser2448]-Antibody-Western-Blot-NB600-607-img0006.jpg)
![N/A TOR/mTOR [p Ser2448] Antibody](https://images.novusbio.com/images2/TOR-mTOR-[p-Ser2448]-Antibody-N-A-NB600-607-img0008.jpg)
-Immunohistochemistry-Paraffin-H00023049-M02-img0005.jpg)
-Western-Blot-H00023049-M02-img0007.jpg)
-Sandwich-ELISA-H00023049-M02-img0006.jpg)
-Flow-Cytometry-NBP2-01764-img0001.jpg)
-Western-Blot-NBP2-01764-img0002.jpg)
-Immunohistochemistry-Paraffin-NBP2-01764-img0003.jpg)
-ELISA-NBP2-22128-img0001.jpg)
-Western-Blot-NBP2-22128-img0002.jpg)
-Immunocytochemistry-Immunofluorescence-NBP2-22128-img0003.jpg)
![SDS-PAGE BMP-6 [Unconjugated]](https://images.novusbio.com/images2/BMP-6_507-BP_CF_375.jpg)
![Bioactivity BMP-6 [Unconjugated]](https://images.novusbio.com/images2/BMP-6_507-BP_CF_377.jpg)
![Flow Cytometry TGF-beta RIII Antibody [Unconjugated]](https://images.novusbio.com/images2/TGF-beta_RIII_AF-242-PB_Flow_Cytometry_3386.jpg)
![Immunohistochemistry TGF-beta RIII Antibody [Unconjugated]](https://images.novusbio.com/images2/TGFbeta_RIII_AF242PB_Immunohistochemistry_24178.jpg)
![Flow Cytometry TGF-beta RIII Antibody [Unconjugated]](https://images.novusbio.com/images2/af-242-pb_human-tgf-beta-riii-affinity-purified-polyclonal-ab-flow-cytometry-276202216543.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")