ETS1 associated protein II Antibody - BSA Free Summary
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human ETS1 associated protein II (NP_057698.2).
Sequence: MELGSCLEGGREAAEEEGEPEVKKRRLLCVEFASVASCDAAVAQCFLAENDWEMERALNSYFEPPVEESALERRPETISEPKTYVDLTNEETTDSTTSKISPSEDTQQENGSMFSLITWNIDGLDLNNLSERARGVCSYLALYSPDVIFLQEVIPPYYSYLKKRSSNYEIITGHEEGYFTAIMLKKSRVKLKSQEIIPFP |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
TDP2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Western Blot 1:1000 - 1:5000
|
| Theoretical MW |
41 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.01% Thimerosal |
| Purity |
Affinity purified |
Alternate Names for ETS1 associated protein II Antibody - BSA Free
Background
Ets proteins constitute a family of conserved sequence-specific DNA-binding proteins and function as transcription factors with roles in differentiation, lymphoid cell development, invasiveness and angiogenesis. A novel ETS1 interacting protein designated as ETS1-associated protein II (EAPII) interacts with ETS1 and other Ets proteins (ETS2 and FLI1) and is a novel ETS1 modulator.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, PLA, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Mu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Ch, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, In vitro, Simple Western, WB
Species: Hu, Mu, Rt
Applications: B/N, In vitro
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, PLA, WB
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ChIP-EXO-SEQ, Flow, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PLA, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB, ELISA
Publications for ETS1 associated protein II Antibody (NBP3-37946) (0)
There are no publications for ETS1 associated protein II Antibody (NBP3-37946).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ETS1 associated protein II Antibody (NBP3-37946) (0)
There are no reviews for ETS1 associated protein II Antibody (NBP3-37946).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ETS1 associated protein II Antibody (NBP3-37946) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ETS1 associated protein II Products
Research Areas for ETS1 associated protein II Antibody (NBP3-37946)
Find related products by research area.
|
Blogs on ETS1 associated protein II