THEM2 Antibody - BSA Free

Western Blot: THEM2 Antibody [NBP1-92498] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

Immunocytochemistry/Immunofluorescence: THEM2 Antibody [NBP1-92498] - Immunofluorescent staining of human cell line A-431 shows localization to cell junctions.

Immunohistochemistry-Paraffin: THEM2 Antibody [NBP1-92498] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Western Blot: THEM2 Antibody [NBP1-92498] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue. Lane 6: Human tonsil tissue

Staining of human prostate shows moderate granular cytoplasmic positivity in glandular cells.

Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.

Analysis in human kidney and skeletal muscle tissues using NBP1-92498 antibody. Corresponding ACOT13 RNA-seq data are presented for the same tissues.

Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.

Staining of human skeletal muscle shows no positivity in myocytes as expected.

Analysis in human cell line HDLM-2.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

THEM2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit THEM2 Antibody - BSA Free (NBP1-92498) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GAPGVSVDMNITYMSPAKLGEDIVITAHVLKQGKTLAFTSVDLTNKATGKLIAQGRHTKHLGN
• Predicted Species: Mouse (92%), Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ACOT13
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  THEM2 Protein (NBP1-92498PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for THEM2 Antibody - BSA Free

• acyl-CoA thioesterase 13PNAS-27
• EC 3.1.2.-
• HT012
• hypothalamus protein HT012
• MGC4961
• THEM2
• Thioesterase superfamily member 2acyl-coenzyme A thioesterase 13

Background

THEM2 encodes a member of the thioesterase superfamily. In humans, the protein co-localizes with microtubules and is essential for sustained cell proliferation. The orthologous mouse protein forms a homotetramer and is associated with mitochondria. The mouse protein functions as a medium- and long-chain acyl-CoA thioesterase. Multiple transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ACOT13