ETS1 associated protein II Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ETS1 associated protein II Antibody [NBP2-55948] - Staining of human cell line HEK 293 shows localization to nucleoplasm, nuclear bodies & aggresome.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ETS1 associated protein II Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ETS1 associated protein II Antibody - BSA Free (NBP2-55948) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MQEAPESATVIFAGDTNLRDREVTRCGGLPNNIVDVWEFLGKPKHCQYTWDTQMNSNLGITAACKLRFDRIFFRAAAEEGHIIP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TDP2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ETS1 associated protein II Recombinant Protein Antigen (NBP2-55948PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ETS1 associated protein II Antibody - BSA Free

• AD022
• dJ30M3.3
• EAP2
• EAPII
• EC 3.1.4.-
• ETS1-associated protein 2
• ETS1-associated protein II
• MGC111021,5'-Tyr-DNA phosphodiesterase
• MGC9099,5'-tyrosyl-DNA phosphodiesterase
• TRAF and TNF receptor associated protein
• TTRAPTRAF and TNF receptor-associated protein
• Tyr-DNA phosphodiesterase 2
• tyrosyl-DNA phosphodiesterase 2

Background

Ets proteins constitute a family of conserved sequence-specific DNA-binding proteins and function as transcription factors with roles in differentiation, lymphoid cell development, invasiveness and angiogenesis. A novel ETS1 interacting protein designated as ETS1-associated protein II (EAPII) interacts with ETS1 and other Ets proteins (ETS2 and FLI1) and is a novel ETS1 modulator.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TDP2