ETS1 associated protein II Antibody


Immunocytochemistry/ Immunofluorescence: ETS1 associated protein II Antibody [NBP2-55948] - Staining of human cell line HEK 293 shows localization to nucleoplasm, nuclear bodies & aggresome.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF

Order Details

ETS1 associated protein II Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MQEAPESATVIFAGDTNLRDREVTRCGGLPNNIVDVWEFLGKPKHCQYTWDTQMNSNLGITAACKLRFDRIFFRAAAEEGHIIP
Specificity of human ETS1 associated protein II antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ETS1 associated protein II Recombinant Protein Antigen (NBP2-55948PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for ETS1 associated protein II Antibody

  • AD022
  • dJ30M3.3
  • EAP2
  • EC 3.1.4.-
  • ETS1-associated protein 2
  • ETS1-associated protein II
  • MGC111021,5'-Tyr-DNA phosphodiesterase
  • MGC9099,5'-tyrosyl-DNA phosphodiesterase
  • TRAF and TNF receptor associated protein
  • TTRAPTRAF and TNF receptor-associated protein
  • Tyr-DNA phosphodiesterase 2
  • tyrosyl-DNA phosphodiesterase 2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, ELISA, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, ChIP, KD
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt, Ch
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, In vitro
Species: Hu, Mu, Rt
Species: Hu, Rt, Rb
Applications: WB, Flow, IHC, IHC-P, KO
Species: Hu, Mu
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-P, IP, PLA, KD
Species: Hu, Mu, Rt
Applications: WB, ICC
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
Species: Hu, Rt, Pm
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF

Publications for ETS1 associated protein II Antibody (NBP2-55948) (0)

There are no publications for ETS1 associated protein II Antibody (NBP2-55948).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ETS1 associated protein II Antibody (NBP2-55948) (0)

There are no reviews for ETS1 associated protein II Antibody (NBP2-55948). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ETS1 associated protein II Antibody (NBP2-55948) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional ETS1 associated protein II Products

Bioinformatics Tool for ETS1 associated protein II Antibody (NBP2-55948)

Discover related pathways, diseases and genes to ETS1 associated protein II Antibody (NBP2-55948). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ETS1 associated protein II Antibody (NBP2-55948)

Discover more about diseases related to ETS1 associated protein II Antibody (NBP2-55948).

Pathways for ETS1 associated protein II Antibody (NBP2-55948)

View related products by pathway.

PTMs for ETS1 associated protein II Antibody (NBP2-55948)

Learn more about PTMs related to ETS1 associated protein II Antibody (NBP2-55948).

Research Areas for ETS1 associated protein II Antibody (NBP2-55948)

Find related products by research area.

Blogs on ETS1 associated protein II

There are no specific blogs for ETS1 associated protein II, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ETS1 associated protein II Antibody and receive a gift card or discount.


Gene Symbol TDP2